BLASTX nr result
ID: Mentha27_contig00010787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00010787 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007136477.1| hypothetical protein PHAVU_009G048500g [Phas... 59 5e-07 ref|XP_006578886.1| PREDICTED: UPF0160 protein MYG1, mitochondri... 59 7e-07 ref|XP_003523345.1| PREDICTED: UPF0160 protein MYG1, mitochondri... 59 7e-07 ref|XP_002321381.1| hypothetical protein POPTR_0015s01030g [Popu... 57 2e-06 ref|XP_006291319.1| hypothetical protein CARUB_v10017452mg, part... 57 3e-06 gb|EXC21395.1| hypothetical protein L484_011836 [Morus notabilis] 57 4e-06 ref|XP_007211191.1| hypothetical protein PRUPE_ppa007611mg [Prun... 56 6e-06 ref|XP_004502701.1| PREDICTED: UPF0160 protein MYG1, mitochondri... 55 8e-06 >ref|XP_007136477.1| hypothetical protein PHAVU_009G048500g [Phaseolus vulgaris] gi|561009564|gb|ESW08471.1| hypothetical protein PHAVU_009G048500g [Phaseolus vulgaris] Length = 352 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +3 Query: 6 INFHAKSWLPARSVVMNSLLARKSTDSSGEIIMLTHSVP 122 +N++AKSWLPARS+VM SL AR+S DSSGEII L+ S P Sbjct: 216 VNYYAKSWLPARSIVMESLAARESVDSSGEIIKLSRSCP 254 >ref|XP_006578886.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like isoform X4 [Glycine max] Length = 308 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 6 INFHAKSWLPARSVVMNSLLARKSTDSSGEIIMLTHSVP 122 +N++AKSWLPARS+VM+SL AR+S DSSGEI+ L S P Sbjct: 220 VNYYAKSWLPARSIVMDSLAARESVDSSGEIVKLNRSCP 258 >ref|XP_003523345.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like isoform X1 [Glycine max] gi|571451919|ref|XP_006578884.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like isoform X2 [Glycine max] gi|571451921|ref|XP_006578885.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like isoform X3 [Glycine max] Length = 356 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 6 INFHAKSWLPARSVVMNSLLARKSTDSSGEIIMLTHSVP 122 +N++AKSWLPARS+VM+SL AR+S DSSGEI+ L S P Sbjct: 220 VNYYAKSWLPARSIVMDSLAARESVDSSGEIVKLNRSCP 258 >ref|XP_002321381.1| hypothetical protein POPTR_0015s01030g [Populus trichocarpa] gi|222868377|gb|EEF05508.1| hypothetical protein POPTR_0015s01030g [Populus trichocarpa] Length = 361 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 6 INFHAKSWLPARSVVMNSLLARKSTDSSGEIIMLTHSVP 122 INFHAKSWLPARS+VM L +R+ D SGEI++LT S P Sbjct: 225 INFHAKSWLPARSIVMECLASREDIDHSGEIMVLTRSCP 263 >ref|XP_006291319.1| hypothetical protein CARUB_v10017452mg, partial [Capsella rubella] gi|482560026|gb|EOA24217.1| hypothetical protein CARUB_v10017452mg, partial [Capsella rubella] Length = 375 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 3 CINFHAKSWLPARSVVMNSLLARKSTDSSGEIIMLTHSVP 122 CI+FHAKSWLPARS+VM L R TDSSGEI+ L+ P Sbjct: 238 CIHFHAKSWLPARSIVMECLAKRYDTDSSGEIMKLSKQCP 277 >gb|EXC21395.1| hypothetical protein L484_011836 [Morus notabilis] Length = 358 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 6 INFHAKSWLPARSVVMNSLLARKSTDSSGEIIMLTHSVP 122 +NF+AKSWLPARS+VM L AR++ D SGEII+LT S P Sbjct: 220 LNFYAKSWLPARSIVMECLAARENIDPSGEIIVLTKSCP 258 >ref|XP_007211191.1| hypothetical protein PRUPE_ppa007611mg [Prunus persica] gi|462406926|gb|EMJ12390.1| hypothetical protein PRUPE_ppa007611mg [Prunus persica] Length = 362 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 6 INFHAKSWLPARSVVMNSLLARKSTDSSGEIIMLTHSVP 122 + FHAKSWLPARS+VM LLAR S D SGEI++LT P Sbjct: 226 VRFHAKSWLPARSIVMECLLARWSVDPSGEIMVLTRFCP 264 >ref|XP_004502701.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like isoform X1 [Cicer arietinum] gi|502136472|ref|XP_004502702.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like isoform X2 [Cicer arietinum] gi|502136475|ref|XP_004502703.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like isoform X3 [Cicer arietinum] gi|502136478|ref|XP_004502704.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like isoform X4 [Cicer arietinum] Length = 358 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 6 INFHAKSWLPARSVVMNSLLARKSTDSSGEIIMLTHSVP 122 +N++AKSWLPARS+VM L AR++ DSSGEII L S P Sbjct: 222 VNYYAKSWLPARSIVMECLAARETIDSSGEIIKLNRSCP 260