BLASTX nr result
ID: Mentha27_contig00010698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00010698 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437437.1| hypothetical protein CICLE_v10033027mg [Citr... 56 6e-06 ref|XP_002325870.2| hypothetical protein POPTR_0019s05800g [Popu... 56 6e-06 >ref|XP_006437437.1| hypothetical protein CICLE_v10033027mg [Citrus clementina] gi|568862254|ref|XP_006484600.1| PREDICTED: dnaJ homolog subfamily C member 7 homolog isoform X2 [Citrus sinensis] gi|557539633|gb|ESR50677.1| hypothetical protein CICLE_v10033027mg [Citrus clementina] Length = 123 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 111 MDSNLNPTSYKDYYKILQVDYDATDDAIRLNYRKLAL 1 M+ N N T KDYYKIL+VDYDATD+ IRLNYRKLAL Sbjct: 1 MEGNDNNTQ-KDYYKILEVDYDATDEKIRLNYRKLAL 36 >ref|XP_002325870.2| hypothetical protein POPTR_0019s05800g [Populus trichocarpa] gi|550316891|gb|EEF00252.2| hypothetical protein POPTR_0019s05800g [Populus trichocarpa] Length = 123 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 111 MDSNLNPTSYKDYYKILQVDYDATDDAIRLNYRKLAL 1 M+ N N T+ KDYYKIL+VDYDATD+ IRLNYR+LAL Sbjct: 1 MEGNEN-TTQKDYYKILEVDYDATDEKIRLNYRRLAL 36