BLASTX nr result
ID: Mentha27_contig00009988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00009988 (763 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006293498.1| hypothetical protein CARUB_v10023563mg [Caps... 120 5e-25 ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabi... 118 2e-24 ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 118 2e-24 emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] 118 2e-24 ref|NP_181493.1| putative dolichyl-phosphate beta-glucosyltransf... 118 2e-24 ref|XP_006411189.1| hypothetical protein EUTSA_v10016901mg [Eutr... 117 3e-24 ref|XP_002315224.1| glycosyl transferase family 2 family protein... 117 3e-24 ref|XP_003552702.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 117 4e-24 ref|XP_006435986.1| hypothetical protein CICLE_v10032053mg [Citr... 117 6e-24 ref|XP_007218274.1| hypothetical protein PRUPE_ppa008313mg [Prun... 116 8e-24 ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase,... 116 8e-24 ref|XP_007009343.1| Nucleotide-diphospho-sugar transferases supe... 115 2e-23 ref|XP_007139212.1| hypothetical protein PHAVU_008G010800g [Phas... 114 4e-23 ref|XP_003518645.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 114 4e-23 ref|XP_006345962.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 114 5e-23 ref|XP_004239791.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 112 1e-22 ref|XP_004492149.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 112 2e-22 ref|XP_003622025.1| Dolichyl-phosphate beta-glucosyltransferase ... 110 4e-22 ref|XP_003622024.1| Dolichyl-phosphate beta-glucosyltransferase ... 110 4e-22 ref|XP_003622023.1| Dolichyl-phosphate beta-glucosyltransferase ... 110 4e-22 >ref|XP_006293498.1| hypothetical protein CARUB_v10023563mg [Capsella rubella] gi|482562206|gb|EOA26396.1| hypothetical protein CARUB_v10023563mg [Capsella rubella] Length = 342 Score = 120 bits (301), Expect = 5e-25 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK F IPM+EISV WSEIPGSKVN+ SIPNMLWELALMSVGYRTGMWKI Sbjct: 274 RWCFDVELVYLCKRFNIPMVEISVKWSEIPGSKVNMLSIPNMLWELALMSVGYRTGMWKI 333 >ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] gi|297327505|gb|EFH57925.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] Length = 336 Score = 118 bits (296), Expect = 2e-24 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK F IPM+EISV WSEIPGSKV++ SIPNMLWELALMSVGYRTGMWKI Sbjct: 274 RWCFDVELVYLCKRFNIPMVEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMWKI 333 >ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Vitis vinifera] gi|296086237|emb|CBI31678.3| unnamed protein product [Vitis vinifera] Length = 336 Score = 118 bits (296), Expect = 2e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK+F IPMIEISV+WSEIPGSKVN SIPNMLWELALMS GYRTGMWKI Sbjct: 275 RWCFDVELVYLCKWFGIPMIEISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMWKI 334 >emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] Length = 251 Score = 118 bits (296), Expect = 2e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK+F IPMIEISV+WSEIPGSKVN SIPNMLWELALMS GYRTGMWKI Sbjct: 190 RWCFDVELVYLCKWFGIPMIEISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMWKI 249 >ref|NP_181493.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|15810211|gb|AAL07006.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|18700244|gb|AAL77732.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|20197112|gb|AAM14922.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|330254605|gb|AEC09699.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|591402142|gb|AHL38798.1| glycosyltransferase, partial [Arabidopsis thaliana] Length = 336 Score = 118 bits (296), Expect = 2e-24 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK F IPM+EISV WSEIPGSKV++ SIPNMLWELALMSVGYRTGMWKI Sbjct: 274 RWCFDVELVYLCKRFNIPMVEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMWKI 333 >ref|XP_006411189.1| hypothetical protein EUTSA_v10016901mg [Eutrema salsugineum] gi|557112358|gb|ESQ52642.1| hypothetical protein EUTSA_v10016901mg [Eutrema salsugineum] Length = 336 Score = 117 bits (294), Expect = 3e-24 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK F IPM+EISV+WSEIPGSKV+L SIPNMLWELALMSVGYRTGMWKI Sbjct: 274 RWCFDVELVFLCKRFNIPMLEISVNWSEIPGSKVSLLSIPNMLWELALMSVGYRTGMWKI 333 >ref|XP_002315224.1| glycosyl transferase family 2 family protein [Populus trichocarpa] gi|222864264|gb|EEF01395.1| glycosyl transferase family 2 family protein [Populus trichocarpa] Length = 335 Score = 117 bits (294), Expect = 3e-24 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVEL++LCK+F IPMIEISV+WSEIPGSKVNL SIPNMLWELALMSVGYRT MWKI Sbjct: 274 RWCFDVELIFLCKWFGIPMIEISVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTRMWKI 333 >ref|XP_003552702.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Glycine max] Length = 333 Score = 117 bits (293), Expect = 4e-24 Identities = 52/60 (86%), Positives = 57/60 (95%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK+FRIP+ EISV+WSEIPGSKVNL SIPNMLWEL LMSVGYRTGMW+I Sbjct: 270 RWCFDVELVFLCKWFRIPVSEISVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWRI 329 >ref|XP_006435986.1| hypothetical protein CICLE_v10032053mg [Citrus clementina] gi|568865484|ref|XP_006486104.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Citrus sinensis] gi|557538182|gb|ESR49226.1| hypothetical protein CICLE_v10032053mg [Citrus clementina] Length = 335 Score = 117 bits (292), Expect = 6e-24 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK F IP+IEISV+WSEIPGSKVN SIPNMLWELALMSVGYRTGMWK+ Sbjct: 274 RWCFDVELVYLCKRFGIPIIEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTGMWKV 333 Query: 181 Q 183 + Sbjct: 334 R 334 >ref|XP_007218274.1| hypothetical protein PRUPE_ppa008313mg [Prunus persica] gi|462414736|gb|EMJ19473.1| hypothetical protein PRUPE_ppa008313mg [Prunus persica] Length = 337 Score = 116 bits (291), Expect = 8e-24 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK+FRI MIEISV+WSEIPGSKVN SIPNMLWEL LMSVGYRTGMW+I Sbjct: 276 RWCFDVELVYLCKWFRIRMIEISVNWSEIPGSKVNPLSIPNMLWELVLMSVGYRTGMWQI 335 Query: 181 Q 183 + Sbjct: 336 R 336 >ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] gi|223529581|gb|EEF31531.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] Length = 335 Score = 116 bits (291), Expect = 8e-24 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVE+VYLCK+F IPMIEISV+WSEIPGSKVN SIPNMLWELA+MS+GYRTGMW+I Sbjct: 274 RWCFDVEVVYLCKWFSIPMIEISVNWSEIPGSKVNPLSIPNMLWELAIMSIGYRTGMWEI 333 >ref|XP_007009343.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] gi|508726256|gb|EOY18153.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] Length = 335 Score = 115 bits (287), Expect = 2e-23 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK+F IPM+EISV+WSEIPGSKVN SIPNMLWELALMSVGYRT MWKI Sbjct: 274 RWCFDVELVFLCKWFSIPMLEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTRMWKI 333 >ref|XP_007139212.1| hypothetical protein PHAVU_008G010800g [Phaseolus vulgaris] gi|593331574|ref|XP_007139213.1| hypothetical protein PHAVU_008G010800g [Phaseolus vulgaris] gi|561012345|gb|ESW11206.1| hypothetical protein PHAVU_008G010800g [Phaseolus vulgaris] gi|561012346|gb|ESW11207.1| hypothetical protein PHAVU_008G010800g [Phaseolus vulgaris] Length = 333 Score = 114 bits (285), Expect = 4e-23 Identities = 50/60 (83%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK F+IP+ E+SV+WSEIPGSKVNL SIPNMLWEL LMSVGYRTGMW+I Sbjct: 270 RWCFDVELVFLCKRFKIPISEVSVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWRI 329 >ref|XP_003518645.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Glycine max] gi|571439407|ref|XP_006574851.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Glycine max] gi|571439409|ref|XP_006574852.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X3 [Glycine max] Length = 333 Score = 114 bits (285), Expect = 4e-23 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK+FRI + EISV+WSEIPGSKVNL SIPNMLWEL LMSVGYRTGMW+I Sbjct: 270 RWCFDVELVFLCKWFRISISEISVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWRI 329 >ref|XP_006345962.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Solanum tuberosum] Length = 335 Score = 114 bits (284), Expect = 5e-23 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK+FR+ M EISV+W+EIPGSKVNL SIPNMLWE+A+MS+GYRTG+WKI Sbjct: 274 RWCFDVELVYLCKWFRVSMNEISVNWTEIPGSKVNLLSIPNMLWEMAIMSLGYRTGIWKI 333 >ref|XP_004239791.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Solanum lycopersicum] Length = 335 Score = 112 bits (281), Expect = 1e-22 Identities = 48/60 (80%), Positives = 57/60 (95%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELVYLCK+FR+ M EISV+W+EIPGSKVNL SIPNMLWE+A+MS+GYRTG+W+I Sbjct: 274 RWCFDVELVYLCKWFRVSMNEISVNWTEIPGSKVNLLSIPNMLWEMAIMSLGYRTGIWRI 333 >ref|XP_004492149.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Cicer arietinum] Length = 333 Score = 112 bits (279), Expect = 2e-22 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK+FRIP+ EISV+WSEIPGSKVNL SIPNM+WEL LMSVGYR G+W+I Sbjct: 270 RWCFDVELVFLCKWFRIPISEISVNWSEIPGSKVNLLSIPNMVWELLLMSVGYRIGIWRI 329 >ref|XP_003622025.1| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula] gi|355497040|gb|AES78243.1| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula] Length = 197 Score = 110 bits (276), Expect = 4e-22 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK+FRIP+ EISV WSEIPGSKVNL SIPNM+WEL LMSVGYR G+W+I Sbjct: 134 RWCFDVELVFLCKWFRIPISEISVIWSEIPGSKVNLLSIPNMVWELLLMSVGYRIGVWRI 193 >ref|XP_003622024.1| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula] gi|355497039|gb|AES78242.1| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula] Length = 330 Score = 110 bits (276), Expect = 4e-22 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK+FRIP+ EISV WSEIPGSKVNL SIPNM+WEL LMSVGYR G+W+I Sbjct: 267 RWCFDVELVFLCKWFRIPISEISVIWSEIPGSKVNLLSIPNMVWELLLMSVGYRIGVWRI 326 >ref|XP_003622023.1| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula] gi|355497038|gb|AES78241.1| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula] Length = 328 Score = 110 bits (276), Expect = 4e-22 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = +1 Query: 1 RWCFDVELVYLCKFFRIPMIEISVSWSEIPGSKVNLFSIPNMLWELALMSVGYRTGMWKI 180 RWCFDVELV+LCK+FRIP+ EISV WSEIPGSKVNL SIPNM+WEL LMSVGYR G+W+I Sbjct: 265 RWCFDVELVFLCKWFRIPISEISVIWSEIPGSKVNLLSIPNMVWELLLMSVGYRIGVWRI 324