BLASTX nr result
ID: Mentha27_contig00009706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00009706 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23551.1| hypothetical protein MIMGU_mgv1a001433mg [Mimulus... 57 2e-06 >gb|EYU23551.1| hypothetical protein MIMGU_mgv1a001433mg [Mimulus guttatus] Length = 820 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/72 (38%), Positives = 46/72 (63%) Frame = +3 Query: 9 LKIGECEGLSQCFVDDLASRFDNPTSLKSLDIRRCGGIECIWRSDLHGVGLQASQISETL 188 +K ECEGLS CF D F+ P+SL +L+I++CG IECI ++D H V L+ ++ Sbjct: 583 VKFYECEGLSNCFSDG----FEIPSSLHTLEIKKCGKIECILKNDRHSVALEHVTLANLP 638 Query: 189 ETLEVIWLEDLD 224 + + VI ++++ Sbjct: 639 DFMGVIHKQNIE 650