BLASTX nr result
ID: Mentha27_contig00009602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00009602 (616 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43400.1| hypothetical protein MIMGU_mgv1a022983mg [Mimulus... 70 6e-10 >gb|EYU43400.1| hypothetical protein MIMGU_mgv1a022983mg [Mimulus guttatus] Length = 377 Score = 69.7 bits (169), Expect = 6e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +1 Query: 1 ELQKFKERWERAVKEDKRWVDPFPPSPSRKLRLNRKRSHSKV 126 ELQKFKERWERAV EDK+WVDPFP + RKLR N KR+ SKV Sbjct: 336 ELQKFKERWERAVDEDKKWVDPFPLTRKRKLRRNNKRNFSKV 377