BLASTX nr result
ID: Mentha27_contig00009022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00009022 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Mimulus... 77 2e-12 ref|XP_002284111.1| PREDICTED: zinc finger protein ZAT12-like [V... 59 9e-07 gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichoca... 56 6e-06 dbj|BAA21923.1| ZPT2-14 [Petunia x hybrida] 55 8e-06 ref|XP_002528469.1| nucleic acid binding protein, putative [Rici... 55 8e-06 >gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Mimulus guttatus] Length = 183 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 3 LSPPFAPIVKKSNSRRVLCLDLNLTPSENKFMFGNVAPAVDCLF 134 LS PIVKKSNSRRVLC+DLNLTPSENKF+FGNVAPAV+C F Sbjct: 140 LSSSSPPIVKKSNSRRVLCMDLNLTPSENKFLFGNVAPAVNCFF 183 >ref|XP_002284111.1| PREDICTED: zinc finger protein ZAT12-like [Vitis vinifera] Length = 176 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 3/43 (6%) Frame = +3 Query: 9 PPFAPIVKKSNSRRVLCLDLNLTPSEN---KFMFGNVAPAVDC 128 PP AP++KK NSRRVLCLDLNLTP EN +F G VA VDC Sbjct: 132 PPQAPLLKKPNSRRVLCLDLNLTPLENIDLQFQLGKVASMVDC 174 >gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichocarpa] Length = 179 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 30/41 (73%), Gaps = 3/41 (7%) Frame = +3 Query: 21 PIVKKSNSRRVLCLDLNLTPSENK---FMFGNVAPAVDCLF 134 P+VK+SNSRRVLCLDLNLTP EN F G AP V+C F Sbjct: 139 PVVKRSNSRRVLCLDLNLTPYENDMELFKLGTTAPMVNCFF 179 >dbj|BAA21923.1| ZPT2-14 [Petunia x hybrida] Length = 166 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +3 Query: 21 PIVKKSNSRRVLCLDLNLTPSEN---KFMFGNVAPAVDCL 131 P+VKKSNSRRVLCLDLNLTP EN +F G A VDCL Sbjct: 126 PVVKKSNSRRVLCLDLNLTPLENDNLEFKLGKAARIVDCL 165 >ref|XP_002528469.1| nucleic acid binding protein, putative [Ricinus communis] gi|223532145|gb|EEF33952.1| nucleic acid binding protein, putative [Ricinus communis] Length = 190 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = +3 Query: 21 PIVKKSNSRRVLCLDLNLTPSENK---FMFGNVAPAVDC 128 P++KKSNSRRVLCLDLNLTP EN F G AP VDC Sbjct: 150 PVMKKSNSRRVLCLDLNLTPYENDVELFRLGKTAPMVDC 188