BLASTX nr result
ID: Mentha27_contig00008859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00008859 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40784.1| hypothetical protein MIMGU_mgv1a0215071mg, partia... 65 1e-08 >gb|EYU40784.1| hypothetical protein MIMGU_mgv1a0215071mg, partial [Mimulus guttatus] Length = 232 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/84 (39%), Positives = 47/84 (55%) Frame = -1 Query: 259 DTTLQLFPELPQCFTFANFSLLHSPSVASVAFTFSPNITFFTCCNQTPKHDVQDYFQSYL 80 D +LQ + CF+F N +L P S++F+FSPN+T F C N+T K + YF++YL Sbjct: 85 DHSLQSLLDTNSCFSFINLTL---PKYPSISFSFSPNLTMFECFNETYKSERGRYFENYL 141 Query: 79 RKDCQASTVYYKIPATHRHAPAIP 8 C +YY P T AP +P Sbjct: 142 NYTCSLIALYYSFP-TANVAPPVP 164