BLASTX nr result
ID: Mentha27_contig00008729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00008729 (583 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46788.1| hypothetical protein MIMGU_mgv1a003818mg [Mimulus... 59 7e-11 ref|XP_002269885.1| PREDICTED: CTP synthase [Vitis vinifera] gi|... 59 1e-10 emb|CAN83528.1| hypothetical protein VITISV_002058 [Vitis vinifera] 59 1e-10 ref|XP_002320316.2| hypothetical protein POPTR_0014s11830g [Popu... 56 2e-10 ref|XP_004229408.1| PREDICTED: CTP synthase-like [Solanum lycope... 56 7e-10 ref|XP_007051062.1| CTP synthase family protein isoform 2 [Theob... 52 7e-10 ref|XP_007201171.1| hypothetical protein PRUPE_ppa003624mg [Prun... 57 7e-10 ref|XP_007051061.1| CTP synthase family protein isoform 1 [Theob... 52 7e-10 ref|XP_007145167.1| hypothetical protein PHAVU_007G216100g [Phas... 55 7e-10 ref|XP_003518891.1| PREDICTED: CTP synthase-like isoform X1 [Gly... 55 7e-10 ref|XP_006574537.1| PREDICTED: CTP synthase-like isoform X2 [Gly... 55 7e-10 ref|XP_006436241.1| hypothetical protein CICLE_v10031113mg [Citr... 57 9e-10 ref|XP_004300473.1| PREDICTED: CTP synthase-like isoform 1 [Frag... 57 9e-10 ref|XP_006287406.1| hypothetical protein CARUB_v10000612mg [Caps... 54 9e-10 ref|NP_192121.2| putative CTP synthase [Arabidopsis thaliana] gi... 54 9e-10 ref|XP_006436239.1| hypothetical protein CICLE_v10031113mg [Citr... 57 9e-10 ref|XP_004300474.1| PREDICTED: CTP synthase-like isoform 2 [Frag... 57 9e-10 gb|AAC78703.1| T10M13.13 [Arabidopsis thaliana] gi|7268596|emb|C... 54 9e-10 ref|XP_006436240.1| hypothetical protein CICLE_v10031113mg [Citr... 57 9e-10 ref|XP_002515313.1| ctp synthase, putative [Ricinus communis] gi... 57 1e-09 >gb|EYU46788.1| hypothetical protein MIMGU_mgv1a003818mg [Mimulus guttatus] Length = 562 Score = 59.3 bits (142), Expect(2) = 7e-11 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQLLFSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLLFSVG 171 Score = 33.5 bits (75), Expect(2) = 7e-11 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIK+WIE VS IP+DG+ Sbjct: 117 ITDAIKNWIETVSIIPVDGK 136 >ref|XP_002269885.1| PREDICTED: CTP synthase [Vitis vinifera] gi|297743951|emb|CBI36921.3| unnamed protein product [Vitis vinifera] Length = 560 Score = 59.3 bits (142), Expect(2) = 1e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQLLFSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLLFSVG 171 Score = 32.7 bits (73), Expect(2) = 1e-10 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 +T+AIK+WIE VS IP+DG+ Sbjct: 117 VTDAIKNWIESVSVIPVDGK 136 >emb|CAN83528.1| hypothetical protein VITISV_002058 [Vitis vinifera] Length = 558 Score = 59.3 bits (142), Expect(2) = 1e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQLLFSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLLFSVG 171 Score = 32.7 bits (73), Expect(2) = 1e-10 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 +T+AIK+WIE VS IP+DG+ Sbjct: 117 VTDAIKNWIESVSVIPVDGK 136 >ref|XP_002320316.2| hypothetical protein POPTR_0014s11830g [Populus trichocarpa] gi|550324023|gb|EEE98631.2| hypothetical protein POPTR_0014s11830g [Populus trichocarpa] Length = 629 Score = 55.8 bits (133), Expect(2) = 2e-10 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 + P D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 205 DGPADVCVIELGGTVGDIESMPFIEALRQLSFSVG 239 Score = 35.4 bits (80), Expect(2) = 2e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIKDWIE VS IP+DG+ Sbjct: 185 ITDAIKDWIESVSAIPVDGK 204 >ref|XP_004229408.1| PREDICTED: CTP synthase-like [Solanum lycopersicum] Length = 562 Score = 56.2 bits (134), Expect(2) = 7e-10 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL F+VG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLYFTVG 171 Score = 33.1 bits (74), Expect(2) = 7e-10 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIKDWIE VS P+DG+ Sbjct: 117 ITDAIKDWIESVSLTPVDGK 136 >ref|XP_007051062.1| CTP synthase family protein isoform 2 [Theobroma cacao] gi|508703323|gb|EOX95219.1| CTP synthase family protein isoform 2 [Theobroma cacao] Length = 562 Score = 52.4 bits (124), Expect(2) = 7e-10 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 512 DA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 141 DVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 37.0 bits (84), Expect(2) = 7e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGRSSH 514 IT+AIKDWIE V+ IP+DG+ H Sbjct: 117 ITDAIKDWIESVALIPVDGKQGH 139 >ref|XP_007201171.1| hypothetical protein PRUPE_ppa003624mg [Prunus persica] gi|462396571|gb|EMJ02370.1| hypothetical protein PRUPE_ppa003624mg [Prunus persica] Length = 561 Score = 57.0 bits (136), Expect(2) = 7e-10 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 32.3 bits (72), Expect(2) = 7e-10 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIK WIE VS IP+DG+ Sbjct: 117 ITDAIKTWIESVSLIPVDGK 136 >ref|XP_007051061.1| CTP synthase family protein isoform 1 [Theobroma cacao] gi|508703322|gb|EOX95218.1| CTP synthase family protein isoform 1 [Theobroma cacao] Length = 561 Score = 52.4 bits (124), Expect(2) = 7e-10 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 512 DA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 141 DVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 37.0 bits (84), Expect(2) = 7e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGRSSH 514 IT+AIKDWIE V+ IP+DG+ H Sbjct: 117 ITDAIKDWIESVALIPVDGKQGH 139 >ref|XP_007145167.1| hypothetical protein PHAVU_007G216100g [Phaseolus vulgaris] gi|561018357|gb|ESW17161.1| hypothetical protein PHAVU_007G216100g [Phaseolus vulgaris] Length = 560 Score = 55.5 bits (132), Expect(2) = 7e-10 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL F VG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFQVG 171 Score = 33.9 bits (76), Expect(2) = 7e-10 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIKDWIE V+ IP+DG+ Sbjct: 117 ITDAIKDWIESVAVIPVDGK 136 >ref|XP_003518891.1| PREDICTED: CTP synthase-like isoform X1 [Glycine max] Length = 560 Score = 55.5 bits (132), Expect(2) = 7e-10 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL F VG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFQVG 171 Score = 33.9 bits (76), Expect(2) = 7e-10 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIKDWIE V+ IP+DG+ Sbjct: 117 ITDAIKDWIESVAVIPVDGK 136 >ref|XP_006574537.1| PREDICTED: CTP synthase-like isoform X2 [Glycine max] Length = 528 Score = 55.5 bits (132), Expect(2) = 7e-10 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL F VG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFQVG 171 Score = 33.9 bits (76), Expect(2) = 7e-10 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIKDWIE V+ IP+DG+ Sbjct: 117 ITDAIKDWIESVAVIPVDGK 136 >ref|XP_006436241.1| hypothetical protein CICLE_v10031113mg [Citrus clementina] gi|568865080|ref|XP_006485911.1| PREDICTED: CTP synthase-like [Citrus sinensis] gi|557538437|gb|ESR49481.1| hypothetical protein CICLE_v10031113mg [Citrus clementina] Length = 561 Score = 57.0 bits (136), Expect(2) = 9e-10 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 32.0 bits (71), Expect(2) = 9e-10 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIK+WIE V+ IP+DG+ Sbjct: 117 ITDAIKNWIESVAVIPVDGK 136 >ref|XP_004300473.1| PREDICTED: CTP synthase-like isoform 1 [Fragaria vesca subsp. vesca] Length = 561 Score = 57.0 bits (136), Expect(2) = 9e-10 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 32.0 bits (71), Expect(2) = 9e-10 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AI++WIE VS IP+DG+ Sbjct: 117 ITDAIRNWIESVSVIPVDGK 136 >ref|XP_006287406.1| hypothetical protein CARUB_v10000612mg [Capsella rubella] gi|482556112|gb|EOA20304.1| hypothetical protein CARUB_v10000612mg [Capsella rubella] Length = 556 Score = 53.9 bits (128), Expect(2) = 9e-10 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGQADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 35.0 bits (79), Expect(2) = 9e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIKDWIE VS IP+DG+ Sbjct: 117 ITDAIKDWIESVSLIPVDGK 136 >ref|NP_192121.2| putative CTP synthase [Arabidopsis thaliana] gi|22655204|gb|AAM98192.1| CTP synthase-like protein [Arabidopsis thaliana] gi|332656726|gb|AEE82126.1| putative CTP synthase [Arabidopsis thaliana] Length = 556 Score = 53.9 bits (128), Expect(2) = 9e-10 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGQADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 35.0 bits (79), Expect(2) = 9e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIKDWIE VS IP+DG+ Sbjct: 117 ITDAIKDWIESVSLIPVDGK 136 >ref|XP_006436239.1| hypothetical protein CICLE_v10031113mg [Citrus clementina] gi|557538435|gb|ESR49479.1| hypothetical protein CICLE_v10031113mg [Citrus clementina] Length = 544 Score = 57.0 bits (136), Expect(2) = 9e-10 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 32.0 bits (71), Expect(2) = 9e-10 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIK+WIE V+ IP+DG+ Sbjct: 117 ITDAIKNWIESVAVIPVDGK 136 >ref|XP_004300474.1| PREDICTED: CTP synthase-like isoform 2 [Fragaria vesca subsp. vesca] Length = 543 Score = 57.0 bits (136), Expect(2) = 9e-10 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 32.0 bits (71), Expect(2) = 9e-10 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AI++WIE VS IP+DG+ Sbjct: 117 ITDAIRNWIESVSVIPVDGK 136 >gb|AAC78703.1| T10M13.13 [Arabidopsis thaliana] gi|7268596|emb|CAB80705.1| CTP synthase-like protein [Arabidopsis thaliana] Length = 539 Score = 53.9 bits (128), Expect(2) = 9e-10 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGQADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 35.0 bits (79), Expect(2) = 9e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIKDWIE VS IP+DG+ Sbjct: 117 ITDAIKDWIESVSLIPVDGK 136 >ref|XP_006436240.1| hypothetical protein CICLE_v10031113mg [Citrus clementina] gi|557538436|gb|ESR49480.1| hypothetical protein CICLE_v10031113mg [Citrus clementina] Length = 386 Score = 57.0 bits (136), Expect(2) = 9e-10 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 32.0 bits (71), Expect(2) = 9e-10 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDGR 523 IT+AIK+WIE V+ IP+DG+ Sbjct: 117 ITDAIKNWIESVAVIPVDGK 136 >ref|XP_002515313.1| ctp synthase, putative [Ricinus communis] gi|223545793|gb|EEF47297.1| ctp synthase, putative [Ricinus communis] Length = 561 Score = 57.0 bits (136), Expect(2) = 1e-09 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 524 EAPTDA*VIELGGTLGDIERMPFIEALRQLLFSVG 420 E P D VIELGGT+GDIE MPFIEALRQL FSVG Sbjct: 137 EGPADVCVIELGGTVGDIESMPFIEALRQLSFSVG 171 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = -2 Query: 582 ITEAIKDWIELVSHIPMDG 526 IT+AIK+WIE V+ IP+DG Sbjct: 117 ITDAIKNWIESVATIPVDG 135