BLASTX nr result
ID: Mentha27_contig00008422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00008422 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45632.1| hypothetical protein MIMGU_mgv11b003932mg [Mimulu... 91 2e-16 ref|XP_004298162.1| PREDICTED: leucine-rich repeat receptor-like... 79 9e-13 ref|XP_006359902.1| PREDICTED: probable LRR receptor-like serine... 76 4e-12 ref|XP_004247374.1| PREDICTED: putative leucine-rich repeat rece... 73 5e-11 ref|XP_007223269.1| hypothetical protein PRUPE_ppa004492mg [Prun... 71 2e-10 ref|XP_002281432.1| PREDICTED: probable LRR receptor-like serine... 70 4e-10 ref|XP_003555335.1| PREDICTED: putative leucine-rich repeat rece... 68 1e-09 ref|XP_006489350.1| PREDICTED: probable LRR receptor-like serine... 67 2e-09 ref|XP_006419882.1| hypothetical protein CICLE_v10004756mg [Citr... 67 2e-09 ref|XP_007143225.1| hypothetical protein PHAVU_007G054600g [Phas... 67 3e-09 ref|XP_004496756.1| PREDICTED: putative leucine-rich repeat rece... 67 3e-09 ref|XP_006297437.1| hypothetical protein CARUB_v10013460mg [Caps... 66 4e-09 ref|XP_006408001.1| hypothetical protein EUTSA_v10020522mg [Eutr... 65 7e-09 ref|XP_006408000.1| hypothetical protein EUTSA_v10020522mg [Eutr... 65 7e-09 dbj|BAJ92476.1| predicted protein [Hordeum vulgare subsp. vulgar... 65 7e-09 ref|XP_004962178.1| PREDICTED: leucine-rich repeat receptor-like... 65 1e-08 ref|XP_002311609.1| leucine-rich repeat family protein [Populus ... 65 1e-08 ref|XP_004140259.1| PREDICTED: putative leucine-rich repeat rece... 65 1e-08 ref|XP_003568529.1| PREDICTED: leucine-rich repeat receptor-like... 65 1e-08 ref|NP_187250.1| leucine-rich repeat family protein [Arabidopsis... 64 2e-08 >gb|EYU45632.1| hypothetical protein MIMGU_mgv11b003932mg [Mimulus guttatus] Length = 510 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 GTIPPSLG LQ L E+FLQNNNLTG +P NL K GLTLRYTPGNP LTPPPS Sbjct: 458 GTIPPSLGNLQYLRELFLQNNNLTGSIPSNLISKPGLTLRYTPGNPFLTPPPS 510 >ref|XP_004298162.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510-like [Fragaria vesca subsp. vesca] Length = 502 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 G IP SLG +++L E+FLQNNNLTGQVP +LTGK GL LR++PGN L PPPS Sbjct: 450 GAIPSSLGNIESLRELFLQNNNLTGQVPNSLTGKPGLDLRFSPGNSLSAPPPS 502 >ref|XP_006359902.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g67720-like [Solanum tuberosum] Length = 511 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPP 288 G IPPSLG + +L+E+FLQNNNL+GQ+P +L GK L LR TPGNPLL+ PP Sbjct: 459 GEIPPSLGNIMSLNEIFLQNNNLSGQIPSSLLGKPTLNLRTTPGNPLLSQPP 510 >ref|XP_004247374.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Solanum lycopersicum] Length = 511 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPP 288 G IP SLG + +L+E+FLQNNNL+GQ+P +L GK L LR TPGNPLL+ PP Sbjct: 459 GEIPHSLGNIMSLNEIFLQNNNLSGQIPSSLLGKPTLNLRTTPGNPLLSQPP 510 >ref|XP_007223269.1| hypothetical protein PRUPE_ppa004492mg [Prunus persica] gi|462420205|gb|EMJ24468.1| hypothetical protein PRUPE_ppa004492mg [Prunus persica] Length = 507 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/53 (67%), Positives = 39/53 (73%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 G IP SLG + +L E+FLQNNNLTGQVP LTGK GL LR T GN L PPPS Sbjct: 456 GDIPSSLGNIDSLHELFLQNNNLTGQVPTGLTGKSGLDLR-TSGNSLSAPPPS 507 >ref|XP_002281432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g67720 [Vitis vinifera] gi|297737017|emb|CBI26218.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 G IP SLG + +L E+FLQNNNLTGQVP +LTGK GL L+ PGN + PPS Sbjct: 460 GEIPSSLGNIDSLQELFLQNNNLTGQVPNSLTGKPGLNLKIFPGNNFSSSPPS 512 >ref|XP_003555335.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Glycine max] Length = 510 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 G IP SLG + +L EVFLQNNNLTGQ+P NL GK GL +R T GN L+PP S Sbjct: 459 GEIPSSLGDISSLQEVFLQNNNLTGQIPANLIGKPGLDIR-TSGNNFLSPPAS 510 >ref|XP_006489350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g67720-like isoform X2 [Citrus sinensis] Length = 513 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 G IP SLG +Q+L E+FLQNNNLTGQ+P +L K GL L+ +PGN L +PPPS Sbjct: 462 GEIPSSLGKIQSLRELFLQNNNLTGQIPSSLI-KPGLNLKTSPGNQLSSPPPS 513 >ref|XP_006419882.1| hypothetical protein CICLE_v10004756mg [Citrus clementina] gi|557521755|gb|ESR33122.1| hypothetical protein CICLE_v10004756mg [Citrus clementina] Length = 513 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 G IP SLG +Q+L E+FLQNNNLTGQ+P +L K GL L+ +PGN L +PPPS Sbjct: 462 GEIPSSLGKIQSLRELFLQNNNLTGQIPSSLI-KPGLNLKTSPGNQLSSPPPS 513 >ref|XP_007143225.1| hypothetical protein PHAVU_007G054600g [Phaseolus vulgaris] gi|561016415|gb|ESW15219.1| hypothetical protein PHAVU_007G054600g [Phaseolus vulgaris] Length = 513 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 G +P SLG + +L EVFLQNNNLTG++P +L GK GL +R T GN L+PPPS Sbjct: 462 GEVPSSLGNISSLQEVFLQNNNLTGRIPESLIGKPGLDIR-TSGNNFLSPPPS 513 >ref|XP_004496756.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Cicer arietinum] Length = 509 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPP 291 G IP SLG + +L EVFLQNNNLTGQ+P NL GK GL +R T GN L+PP Sbjct: 458 GEIPSSLGNIGSLKEVFLQNNNLTGQIPANLIGKPGLIIR-TSGNSFLSPP 507 >ref|XP_006297437.1| hypothetical protein CARUB_v10013460mg [Capsella rubella] gi|482566146|gb|EOA30335.1| hypothetical protein CARUB_v10013460mg [Capsella rubella] Length = 519 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPP 291 G IPPSLG + L E+FLQNNNLTGQ+P NL K GL LR T GNP LT P Sbjct: 468 GNIPPSLGGVPHLRELFLQNNNLTGQIPSNLLQKPGLNLR-TSGNPFLTQP 517 >ref|XP_006408001.1| hypothetical protein EUTSA_v10020522mg [Eutrema salsugineum] gi|557109147|gb|ESQ49454.1| hypothetical protein EUTSA_v10020522mg [Eutrema salsugineum] Length = 517 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPP 288 GTIPP G + L E++LQNNNLTGQ+P NL K GL LR T GNP LT PP Sbjct: 466 GTIPPFFGGVPHLRELYLQNNNLTGQIPSNLLQKPGLELR-TSGNPFLTQPP 516 >ref|XP_006408000.1| hypothetical protein EUTSA_v10020522mg [Eutrema salsugineum] gi|557109146|gb|ESQ49453.1| hypothetical protein EUTSA_v10020522mg [Eutrema salsugineum] Length = 419 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPP 288 GTIPP G + L E++LQNNNLTGQ+P NL K GL LR T GNP LT PP Sbjct: 368 GTIPPFFGGVPHLRELYLQNNNLTGQIPSNLLQKPGLELR-TSGNPFLTQPP 418 >dbj|BAJ92476.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326519931|dbj|BAK03890.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 512 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPP 291 GTIP +LGT+Q L E+FLQNN L G VP+NL K GLT ++ PGN PP Sbjct: 461 GTIPQTLGTIQPLRELFLQNNELGGAVPLNLLNKAGLTRKFCPGNQFSQPP 511 >ref|XP_004962178.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510-like [Setaria italica] Length = 535 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPP 288 G++P +LGT+ TL E+FL +N+L+G VP NL KQGLT R+ PGN PPP Sbjct: 483 GSVPRTLGTINTLRELFLYSNSLSGPVPDNLLNKQGLTYRFLPGNLFAPPPP 534 >ref|XP_002311609.1| leucine-rich repeat family protein [Populus trichocarpa] gi|222851429|gb|EEE88976.1| leucine-rich repeat family protein [Populus trichocarpa] Length = 514 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPPS 285 G IP SLG ++ L E+FLQNNNL+GQ+P NL GK GL LR T GN L+P PS Sbjct: 463 GEIPLSLGNIKDLRELFLQNNNLSGQIPNNLIGKPGLNLR-TSGNQFLSPSPS 514 >ref|XP_004140259.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Cucumis sativus] gi|449481196|ref|XP_004156110.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Cucumis sativus] Length = 519 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPP 288 G IP SLG L L E+FL NNNLTG+VP +LT + L LR PGN LL PPP Sbjct: 466 GEIPSSLGNLARLQELFLYNNNLTGEVPQSLTNNERLDLRIFPGNHLLGPPP 517 >ref|XP_003568529.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510-like [Brachypodium distachyon] Length = 513 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/52 (55%), Positives = 35/52 (67%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPPP 288 GTIP +LGT+Q L E+FLQNN L G VP+NL QGL ++ PGN PP Sbjct: 461 GTIPQTLGTIQVLRELFLQNNELVGTVPLNLLNNQGLNSQFVPGNQFSPKPP 512 >ref|NP_187250.1| leucine-rich repeat family protein [Arabidopsis thaliana] gi|6671958|gb|AAF23217.1|AC013454_4 hypothetical protein [Arabidopsis thaliana] gi|30102730|gb|AAP21283.1| At3g05990 [Arabidopsis thaliana] gi|110743247|dbj|BAE99514.1| hypothetical protein [Arabidopsis thaliana] gi|332640806|gb|AEE74327.1| leucine-rich repeat domain-containing protein [Arabidopsis thaliana] Length = 517 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = -3 Query: 443 GTIPPSLGTLQTLSEVFLQNNNLTGQVPINLTGKQGLTLRYTPGNPLLTPP 291 G+IP SLG + L E+FLQNNNLTGQVP NL K GL LR T GNP LT P Sbjct: 466 GSIPSSLGGVPHLRELFLQNNNLTGQVPSNLLQKPGLNLR-TSGNPFLTQP 515