BLASTX nr result
ID: Mentha27_contig00008077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00008077 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007135125.1| hypothetical protein PHAVU_010G103100g [Phas... 55 8e-06 >ref|XP_007135125.1| hypothetical protein PHAVU_010G103100g [Phaseolus vulgaris] gi|561008170|gb|ESW07119.1| hypothetical protein PHAVU_010G103100g [Phaseolus vulgaris] Length = 490 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 117 MSVLDTAFVDTELSNRTSIFGLHLWVVIGIVV 212 MSV D AFVDTELS RTSIFGL LWVVIGI+V Sbjct: 1 MSVYDAAFVDTELSKRTSIFGLRLWVVIGILV 32