BLASTX nr result
ID: Mentha27_contig00007451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00007451 (632 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006345731.1| PREDICTED: rhodanese-like domain-containing ... 66 8e-09 ref|XP_006345730.1| PREDICTED: rhodanese-like domain-containing ... 66 8e-09 gb|EYU17793.1| hypothetical protein MIMGU_mgv1a006537mg [Mimulus... 64 3e-08 ref|NP_001185025.1| rhodanese homology domain-containing protein... 64 4e-08 ref|NP_564039.6| rhodanese homology domain-containing protein [A... 64 4e-08 ref|XP_004980951.1| PREDICTED: rhodanese-like domain-containing ... 63 6e-08 ref|XP_004252197.1| PREDICTED: rhodanese-like domain-containing ... 63 6e-08 ref|XP_006466120.1| PREDICTED: rhodanese-like domain-containing ... 63 8e-08 ref|XP_006466119.1| PREDICTED: rhodanese-like domain-containing ... 63 8e-08 ref|XP_006441385.1| hypothetical protein CICLE_v10020172mg [Citr... 63 8e-08 ref|XP_004299477.1| PREDICTED: rhodanese-like domain-containing ... 63 8e-08 gb|ABR16157.1| unknown [Picea sitchensis] 63 8e-08 ref|XP_007037152.1| Rhodanese/Cell cycle control phosphatase sup... 62 1e-07 ref|XP_007037151.1| Rhodanese/Cell cycle control phosphatase sup... 62 1e-07 ref|XP_003559091.1| PREDICTED: UPF0176 protein pc0378-like [Brac... 62 1e-07 ref|XP_006650937.1| PREDICTED: rhodanese-like domain-containing ... 62 1e-07 gb|EEC76591.1| hypothetical protein OsI_14442 [Oryza sativa Indi... 62 1e-07 ref|NP_001051982.1| Os03g0861700 [Oryza sativa Japonica Group] g... 62 1e-07 gb|AAP44745.1| unknown protein [Oryza sativa Japonica Group] 62 1e-07 gb|AAF97265.1|AC034106_8 Contains a Rhodanese-like PF|00581 doma... 62 2e-07 >ref|XP_006345731.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 306 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSET 631 GYEWDVGHFQGAHRPDVDCFR+TSFG SE+ Sbjct: 106 GYEWDVGHFQGAHRPDVDCFRATSFGQSES 135 >ref|XP_006345730.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 420 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSET 631 GYEWDVGHFQGAHRPDVDCFR+TSFG SE+ Sbjct: 220 GYEWDVGHFQGAHRPDVDCFRATSFGQSES 249 >gb|EYU17793.1| hypothetical protein MIMGU_mgv1a006537mg [Mimulus guttatus] Length = 440 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLS 625 GYEWDVGHFQGA RPDVDCFRSTSFGLS Sbjct: 235 GYEWDVGHFQGAQRPDVDCFRSTSFGLS 262 >ref|NP_001185025.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] gi|384950757|sp|F4I933.1|STR8_ARATH RecName: Full=Rhodanese-like domain-containing protein 8, chloroplastic; AltName: Full=Sulfurtransferase 8; Short=AtStr8; Flags: Precursor gi|332191523|gb|AEE29644.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] Length = 448 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 GYEWDVGHF+GAHRP+VDCFR+TSFGLS+ Sbjct: 232 GYEWDVGHFRGAHRPEVDCFRNTSFGLSD 260 >ref|NP_564039.6| rhodanese homology domain-containing protein [Arabidopsis thaliana] gi|332191522|gb|AEE29643.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] Length = 446 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 GYEWDVGHF+GAHRP+VDCFR+TSFGLS+ Sbjct: 230 GYEWDVGHFRGAHRPEVDCFRNTSFGLSD 258 >ref|XP_004980951.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like [Setaria italica] Length = 439 Score = 63.2 bits (152), Expect = 6e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 GYEWDVGHF+GA RP+VDCFRSTSFGLSE Sbjct: 224 GYEWDVGHFEGAERPNVDCFRSTSFGLSE 252 >ref|XP_004252197.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like [Solanum lycopersicum] Length = 420 Score = 63.2 bits (152), Expect = 6e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSET 631 GYEWDVGHFQGA RPDVDCFR+TSFG SE+ Sbjct: 220 GYEWDVGHFQGAQRPDVDCFRATSFGQSES 249 >ref|XP_006466120.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like isoform X2 [Citrus sinensis] Length = 443 Score = 62.8 bits (151), Expect = 8e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 GYEWD+GHF GA RPDVDCFRSTSFGLS+ Sbjct: 237 GYEWDIGHFHGARRPDVDCFRSTSFGLSQ 265 >ref|XP_006466119.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like isoform X1 [Citrus sinensis] Length = 445 Score = 62.8 bits (151), Expect = 8e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 GYEWD+GHF GA RPDVDCFRSTSFGLS+ Sbjct: 239 GYEWDIGHFHGARRPDVDCFRSTSFGLSQ 267 >ref|XP_006441385.1| hypothetical protein CICLE_v10020172mg [Citrus clementina] gi|557543647|gb|ESR54625.1| hypothetical protein CICLE_v10020172mg [Citrus clementina] Length = 441 Score = 62.8 bits (151), Expect = 8e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 GYEWD+GHF GA RPDVDCFRSTSFGLS+ Sbjct: 235 GYEWDIGHFHGARRPDVDCFRSTSFGLSQ 263 >ref|XP_004299477.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 446 Score = 62.8 bits (151), Expect = 8e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 GYEWD+GHF GA RPDVDCFRSTSFGLS+ Sbjct: 239 GYEWDIGHFSGARRPDVDCFRSTSFGLSQ 267 >gb|ABR16157.1| unknown [Picea sitchensis] Length = 523 Score = 62.8 bits (151), Expect = 8e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSET 631 GYEWD+GHFQGA RPDVDCFRST+FG+S++ Sbjct: 300 GYEWDIGHFQGAKRPDVDCFRSTTFGISDS 329 >ref|XP_007037152.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 2 [Theobroma cacao] gi|508774397|gb|EOY21653.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 2 [Theobroma cacao] Length = 431 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLS 625 GYEWD+GHFQGA RPDVDCFR TSFGLS Sbjct: 230 GYEWDIGHFQGAQRPDVDCFRGTSFGLS 257 >ref|XP_007037151.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 1 [Theobroma cacao] gi|508774396|gb|EOY21652.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 1 [Theobroma cacao] Length = 498 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLS 625 GYEWD+GHFQGA RPDVDCFR TSFGLS Sbjct: 230 GYEWDIGHFQGAQRPDVDCFRGTSFGLS 257 >ref|XP_003559091.1| PREDICTED: UPF0176 protein pc0378-like [Brachypodium distachyon] Length = 429 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 542 GYEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 GYEWD+GHF+GA RP+VDCFRSTSFGLSE Sbjct: 214 GYEWDIGHFEGAKRPNVDCFRSTSFGLSE 242 >ref|XP_006650937.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like, partial [Oryza brachyantha] Length = 366 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 545 YEWDVGHFQGAHRPDVDCFRSTSFGLSET 631 YEWD+GHFQGA RP+VDCFRSTSFGLSE+ Sbjct: 155 YEWDIGHFQGAQRPNVDCFRSTSFGLSES 183 >gb|EEC76591.1| hypothetical protein OsI_14442 [Oryza sativa Indica Group] Length = 426 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 545 YEWDVGHFQGAHRPDVDCFRSTSFGLSET 631 YEWD+GHFQGA RP+VDCFRSTSFGLSE+ Sbjct: 214 YEWDIGHFQGAQRPNVDCFRSTSFGLSES 242 >ref|NP_001051982.1| Os03g0861700 [Oryza sativa Japonica Group] gi|108712235|gb|ABG00030.1| Rhodanese-like domain containing protein, expressed [Oryza sativa Japonica Group] gi|113550453|dbj|BAF13896.1| Os03g0861700 [Oryza sativa Japonica Group] gi|215694644|dbj|BAG89835.1| unnamed protein product [Oryza sativa Japonica Group] Length = 405 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 545 YEWDVGHFQGAHRPDVDCFRSTSFGLSET 631 YEWD+GHFQGA RP+VDCFRSTSFGLSE+ Sbjct: 193 YEWDIGHFQGAQRPNVDCFRSTSFGLSES 221 >gb|AAP44745.1| unknown protein [Oryza sativa Japonica Group] Length = 463 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 545 YEWDVGHFQGAHRPDVDCFRSTSFGLSET 631 YEWD+GHFQGA RP+VDCFRSTSFGLSE+ Sbjct: 241 YEWDIGHFQGAQRPNVDCFRSTSFGLSES 269 >gb|AAF97265.1|AC034106_8 Contains a Rhodanese-like PF|00581 domain. ESTs gb|T45773, gb|AA394520 come from this gene [Arabidopsis thaliana] Length = 423 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +2 Query: 545 YEWDVGHFQGAHRPDVDCFRSTSFGLSE 628 YEWDVGHF+GAHRP+VDCFR+TSFGLS+ Sbjct: 201 YEWDVGHFRGAHRPEVDCFRNTSFGLSD 228