BLASTX nr result
ID: Mentha27_contig00007251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00007251 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242818.1| PREDICTED: uncharacterized protein LOC101260... 55 8e-06 ref|XP_002527805.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_004242818.1| PREDICTED: uncharacterized protein LOC101260152 isoform 1 [Solanum lycopersicum] gi|460394457|ref|XP_004242819.1| PREDICTED: uncharacterized protein LOC101260152 isoform 2 [Solanum lycopersicum] Length = 301 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 87 FNQDGSRQRLTLLVFFASLVYLYQTGALA 1 FNQDGSRQRL LLVF ASLVYLYQTGALA Sbjct: 166 FNQDGSRQRLVLLVFLASLVYLYQTGALA 194 >ref|XP_002527805.1| conserved hypothetical protein [Ricinus communis] gi|223532801|gb|EEF34577.1| conserved hypothetical protein [Ricinus communis] Length = 287 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/54 (59%), Positives = 33/54 (61%) Frame = -2 Query: 165 VVVRRXXXXXXXXXXXXXXXXXXXXLFNQDGSRQRLTLLVFFASLVYLYQTGAL 4 VVVRR LFNQDGSRQRL +LVFFASLVYLYQTGAL Sbjct: 128 VVVRRFQIAFQLDLLLILKLAAVIFLFNQDGSRQRLVVLVFFASLVYLYQTGAL 181