BLASTX nr result
ID: Mentha27_contig00007220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00007220 (602 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31851.1| hypothetical protein MIMGU_mgv1a006331mg [Mimulus... 57 5e-06 >gb|EYU31851.1| hypothetical protein MIMGU_mgv1a006331mg [Mimulus guttatus] Length = 448 Score = 56.6 bits (135), Expect = 5e-06 Identities = 33/50 (66%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = -1 Query: 602 GIHPXXXXXXXXXXXWEMSPEVLALASRM-GEPNRTGGSSSATRGTEPKL 456 GIHP WEMSPEVLALASRM GEPNRT GSSS R TE KL Sbjct: 399 GIHPRRSSWGRKSGSWEMSPEVLALASRMGGEPNRTAGSSSTVRSTEHKL 448