BLASTX nr result
ID: Mentha27_contig00007137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00007137 (527 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42469.1| hypothetical protein MIMGU_mgv1a026807mg [Mimulus... 63 4e-08 >gb|EYU42469.1| hypothetical protein MIMGU_mgv1a026807mg [Mimulus guttatus] Length = 311 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/61 (47%), Positives = 44/61 (72%), Gaps = 4/61 (6%) Frame = -1 Query: 527 SLNVTVYGLFFMNCATASRVFVGIAYTVYYFQCKEYHGEKVELFGNFHY----TTLKSDV 360 S N+ VYGLFF+N + ++F+ AYTVYYFQC ++HGE++ + G+F Y T+L +D+ Sbjct: 252 SQNLQVYGLFFLNFLSLFKIFIFPAYTVYYFQCMKFHGEEI-IIGDFQYSELPTSLGNDI 310 Query: 359 P 357 P Sbjct: 311 P 311