BLASTX nr result
ID: Mentha27_contig00006477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00006477 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41641.1| hypothetical protein MIMGU_mgv1a007412mg [Mimulus... 63 5e-08 gb|EYU38509.1| hypothetical protein MIMGU_mgv1a007416mg [Mimulus... 63 5e-08 ref|NP_187574.1| 60S ribosomal protein L4-1 [Arabidopsis thalian... 62 8e-08 ref|NP_001030663.1| 60S ribosomal protein L4-1 [Arabidopsis thal... 62 8e-08 dbj|BAH20258.1| AT3G09630 [Arabidopsis thaliana] 62 8e-08 gb|AAM65510.1| 60S ribosomal protein L4-B (L1) [Arabidopsis thal... 62 8e-08 ref|XP_006407657.1| hypothetical protein EUTSA_v10020851mg [Eutr... 60 2e-07 ref|XP_006381503.1| hypothetical protein POPTR_0006s13470g [Popu... 60 2e-07 ref|XP_006297818.1| hypothetical protein CARUB_v10013852mg [Caps... 60 2e-07 ref|XP_007205280.1| hypothetical protein PRUPE_ppa006524mg [Prun... 60 2e-07 ref|XP_002882630.1| 60S ribosomal protein L4/L1 [Arabidopsis lyr... 60 2e-07 ref|XP_002322848.1| 60S ribosomal protein L1 [Populus trichocarp... 60 2e-07 gb|ABK96375.1| unknown [Populus trichocarpa x Populus deltoides] 60 2e-07 ref|XP_006381505.1| hypothetical protein POPTR_0006s13480g [Popu... 60 2e-07 gb|EXB84816.1| 60S ribosomal protein L4 [Morus notabilis] 60 3e-07 ref|NP_195907.1| 60S ribosomal protein L4-2 [Arabidopsis thalian... 59 5e-07 ref|XP_006398743.1| hypothetical protein EUTSA_v10013700mg [Eutr... 59 5e-07 ref|XP_004981434.1| PREDICTED: 60S ribosomal protein L4-1-like [... 59 5e-07 ref|XP_006287869.1| hypothetical protein CARUB_v10001096mg [Caps... 59 5e-07 dbj|BAC42280.1| putative 60S ribosomal protein [Arabidopsis thal... 59 5e-07 >gb|EYU41641.1| hypothetical protein MIMGU_mgv1a007412mg [Mimulus guttatus] Length = 408 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 406 ASKSWYKTMISDSDYTEFENFTKWLGASE 320 ASKSWYKTMISDSDYTEF+NFTKWLG SE Sbjct: 380 ASKSWYKTMISDSDYTEFDNFTKWLGVSE 408 >gb|EYU38509.1| hypothetical protein MIMGU_mgv1a007416mg [Mimulus guttatus] Length = 408 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 SASK WYKTMISDSDYTEF+NFTKWLG SE Sbjct: 379 SASKQWYKTMISDSDYTEFDNFTKWLGVSE 408 >ref|NP_187574.1| 60S ribosomal protein L4-1 [Arabidopsis thaliana] gi|17369604|sp|Q9SF40.1|RL4A_ARATH RecName: Full=60S ribosomal protein L4-1; Short=L1 gi|6682241|gb|AAF23293.1|AC016661_18 putative 60S ribosomal protein L1 [Arabidopsis thaliana] gi|15982715|gb|AAL09727.1| AT3g09630/F11F8_22 [Arabidopsis thaliana] gi|27311665|gb|AAO00798.1| putative 60S ribosomal protein L1 [Arabidopsis thaliana] gi|30725664|gb|AAP37854.1| At3g09630 [Arabidopsis thaliana] gi|332641268|gb|AEE74789.1| 60S ribosomal protein L4-1 [Arabidopsis thaliana] Length = 406 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A KSWYKTMISDSDYTEF+NFTKWLGAS+ Sbjct: 377 AAGKSWYKTMISDSDYTEFDNFTKWLGASQ 406 >ref|NP_001030663.1| 60S ribosomal protein L4-1 [Arabidopsis thaliana] gi|332641269|gb|AEE74790.1| 60S ribosomal protein L4-1 [Arabidopsis thaliana] Length = 405 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A KSWYKTMISDSDYTEF+NFTKWLGAS+ Sbjct: 376 AAGKSWYKTMISDSDYTEFDNFTKWLGASQ 405 >dbj|BAH20258.1| AT3G09630 [Arabidopsis thaliana] Length = 173 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A KSWYKTMISDSDYTEF+NFTKWLGAS+ Sbjct: 144 AAGKSWYKTMISDSDYTEFDNFTKWLGASQ 173 >gb|AAM65510.1| 60S ribosomal protein L4-B (L1) [Arabidopsis thaliana] Length = 406 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A KSWYKTMISDSDYTEF+NFTKWLGAS+ Sbjct: 377 AAGKSWYKTMISDSDYTEFDNFTKWLGASQ 406 >ref|XP_006407657.1| hypothetical protein EUTSA_v10020851mg [Eutrema salsugineum] gi|557108803|gb|ESQ49110.1| hypothetical protein EUTSA_v10020851mg [Eutrema salsugineum] Length = 406 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A KSWY+TMISDSDYTEF+NFTKWLGAS+ Sbjct: 377 AAGKSWYQTMISDSDYTEFDNFTKWLGASQ 406 >ref|XP_006381503.1| hypothetical protein POPTR_0006s13470g [Populus trichocarpa] gi|550336207|gb|ERP59300.1| hypothetical protein POPTR_0006s13470g [Populus trichocarpa] Length = 374 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WYKTMISDSDYTEFENFTKWLG S+ Sbjct: 345 AAGKAWYKTMISDSDYTEFENFTKWLGVSQ 374 >ref|XP_006297818.1| hypothetical protein CARUB_v10013852mg [Capsella rubella] gi|482566527|gb|EOA30716.1| hypothetical protein CARUB_v10013852mg [Capsella rubella] Length = 406 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A KSWY+TMISDSDYTEF+NFTKWLGAS+ Sbjct: 377 AAGKSWYQTMISDSDYTEFDNFTKWLGASQ 406 >ref|XP_007205280.1| hypothetical protein PRUPE_ppa006524mg [Prunus persica] gi|462400922|gb|EMJ06479.1| hypothetical protein PRUPE_ppa006524mg [Prunus persica] Length = 408 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WYKTMISDSDYTEFENFTKWLG S+ Sbjct: 379 AAGKAWYKTMISDSDYTEFENFTKWLGVSQ 408 >ref|XP_002882630.1| 60S ribosomal protein L4/L1 [Arabidopsis lyrata subsp. lyrata] gi|297328470|gb|EFH58889.1| 60S ribosomal protein L4/L1 [Arabidopsis lyrata subsp. lyrata] Length = 406 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A KSWY+TMISDSDYTEF+NFTKWLGAS+ Sbjct: 377 AAGKSWYQTMISDSDYTEFDNFTKWLGASQ 406 >ref|XP_002322848.1| 60S ribosomal protein L1 [Populus trichocarpa] gi|222867478|gb|EEF04609.1| 60S ribosomal protein L1 [Populus trichocarpa] Length = 407 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WYKTMISDSDYTEFENFTKWLG S+ Sbjct: 378 AAGKAWYKTMISDSDYTEFENFTKWLGVSQ 407 >gb|ABK96375.1| unknown [Populus trichocarpa x Populus deltoides] Length = 407 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WYKTMISDSDYTEFENFTKWLG S+ Sbjct: 378 AAGKAWYKTMISDSDYTEFENFTKWLGVSQ 407 >ref|XP_006381505.1| hypothetical protein POPTR_0006s13480g [Populus trichocarpa] gi|118486971|gb|ABK95318.1| unknown [Populus trichocarpa] gi|550336209|gb|ERP59302.1| hypothetical protein POPTR_0006s13480g [Populus trichocarpa] Length = 408 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WYKTMISDSDYTEFENFTKWLG S+ Sbjct: 379 AAGKAWYKTMISDSDYTEFENFTKWLGVSQ 408 >gb|EXB84816.1| 60S ribosomal protein L4 [Morus notabilis] Length = 408 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A KSWY+TMISDSDYTEFENFTKWLG S+ Sbjct: 379 AAGKSWYQTMISDSDYTEFENFTKWLGVSQ 408 >ref|NP_195907.1| 60S ribosomal protein L4-2 [Arabidopsis thaliana] gi|20143905|sp|P49691.2|RL4B_ARATH RecName: Full=60S ribosomal protein L4-2; AltName: Full=L1 gi|7413562|emb|CAB86041.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|15450798|gb|AAK96670.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|16649033|gb|AAL24368.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|17064752|gb|AAL32530.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|20260072|gb|AAM13383.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|21387109|gb|AAM47958.1| 60S ribosomal protein-like protein [Arabidopsis thaliana] gi|22530964|gb|AAM96986.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|25083642|gb|AAN72099.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|332003146|gb|AED90529.1| 60S ribosomal protein L4-2 [Arabidopsis thaliana] Length = 407 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WY+TMISDSDYTEF+NFTKWLGAS+ Sbjct: 378 AAGKAWYQTMISDSDYTEFDNFTKWLGASQ 407 >ref|XP_006398743.1| hypothetical protein EUTSA_v10013700mg [Eutrema salsugineum] gi|557099833|gb|ESQ40196.1| hypothetical protein EUTSA_v10013700mg [Eutrema salsugineum] Length = 406 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WY+TMISDSDYTEF+NFTKWLGAS+ Sbjct: 377 AAGKAWYQTMISDSDYTEFDNFTKWLGASQ 406 >ref|XP_004981434.1| PREDICTED: 60S ribosomal protein L4-1-like [Setaria italica] Length = 404 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WYKTMISDSDYTEFENFTKWLG ++ Sbjct: 375 AAGKAWYKTMISDSDYTEFENFTKWLGVTQ 404 >ref|XP_006287869.1| hypothetical protein CARUB_v10001096mg [Capsella rubella] gi|482556575|gb|EOA20767.1| hypothetical protein CARUB_v10001096mg [Capsella rubella] Length = 407 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WY+TMISDSDYTEF+NFTKWLGAS+ Sbjct: 378 AAGKAWYQTMISDSDYTEFDNFTKWLGASQ 407 >dbj|BAC42280.1| putative 60S ribosomal protein [Arabidopsis thaliana] Length = 407 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 409 SASKSWYKTMISDSDYTEFENFTKWLGASE 320 +A K+WY+TMISDSDYTEF+NFTKWLGAS+ Sbjct: 378 AAGKAWYQTMISDSDYTEFDNFTKWLGASQ 407