BLASTX nr result
ID: Mentha27_contig00006067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00006067 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45637.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus... 60 4e-07 gb|EYU45636.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus... 60 4e-07 >gb|EYU45637.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus guttatus] Length = 408 Score = 59.7 bits (143), Expect = 4e-07 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 6/70 (8%) Frame = -2 Query: 193 MSLARPYRPRDGHFRSDGRSSHGR-----MRTTAAAAADYNWSHE-FPSNSDFYTKNRGS 32 MSLA+ YRPRDGHF SDG+SS+GR +R T AAA + +W+++ P N DF N G Sbjct: 1 MSLAQTYRPRDGHFHSDGKSSYGRNSSAGLRAT-AAAINSSWNYDSHPYNLDFGINNHGF 59 Query: 31 SNGFSWELIM 2 S+ S L++ Sbjct: 60 SSDLSRNLML 69 >gb|EYU45636.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus guttatus] Length = 360 Score = 59.7 bits (143), Expect = 4e-07 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 6/70 (8%) Frame = -2 Query: 193 MSLARPYRPRDGHFRSDGRSSHGR-----MRTTAAAAADYNWSHE-FPSNSDFYTKNRGS 32 MSLA+ YRPRDGHF SDG+SS+GR +R T AAA + +W+++ P N DF N G Sbjct: 1 MSLAQTYRPRDGHFHSDGKSSYGRNSSAGLRAT-AAAINSSWNYDSHPYNLDFGINNHGF 59 Query: 31 SNGFSWELIM 2 S+ S L++ Sbjct: 60 SSDLSRNLML 69