BLASTX nr result
ID: Mentha27_contig00003936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00003936 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23762.1| hypothetical protein MIMGU_mgv1a004588mg [Mimulus... 92 7e-17 gb|EYU23761.1| hypothetical protein MIMGU_mgv1a004606mg [Mimulus... 89 5e-16 gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] 88 1e-15 gb|EYU23760.1| hypothetical protein MIMGU_mgv1a026908mg [Mimulus... 87 3e-15 gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] 86 5e-15 ref|XP_007017404.1| Cytochrome P450 82A3, putative [Theobroma ca... 84 2e-14 gb|EYU23763.1| hypothetical protein MIMGU_mgv1a023100mg [Mimulus... 83 4e-14 ref|XP_004489341.1| PREDICTED: cytochrome P450 82A3-like [Cicer ... 82 1e-13 ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula] gi|355... 80 3e-13 ref|XP_002510297.1| cytochrome P450, putative [Ricinus communis]... 80 3e-13 ref|XP_007151140.1| hypothetical protein PHAVU_004G021100g [Phas... 79 6e-13 ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, pol... 79 6e-13 ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus... 78 1e-12 ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citr... 78 1e-12 ref|XP_002282091.2| PREDICTED: cytochrome P450 82A4-like [Vitis ... 77 2e-12 ref|XP_003618366.1| Cytochrome P450 [Medicago truncatula] gi|355... 77 2e-12 ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phas... 77 3e-12 ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]... 77 3e-12 ref|XP_003554859.1| PREDICTED: cytochrome P450 82A4-like [Glycin... 76 4e-12 emb|CBI19610.3| unnamed protein product [Vitis vinifera] 76 4e-12 >gb|EYU23762.1| hypothetical protein MIMGU_mgv1a004588mg [Mimulus guttatus] Length = 519 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RG+DFE IPFGAGRRICPG NFGLHMLHLVLA+FL AF+V TV D+ VDM+ES Sbjct: 443 RGKDFEFIPFGAGRRICPGTNFGLHMLHLVLANFLQAFDVTTVSDQAVDMTES 495 >gb|EYU23761.1| hypothetical protein MIMGU_mgv1a004606mg [Mimulus guttatus] Length = 518 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RG+DFE IPFGAGRRICPG NFGLHMLHLVLA+ L AF+V TV D+ VDM+ES Sbjct: 442 RGKDFEFIPFGAGRRICPGTNFGLHMLHLVLANVLQAFDVTTVSDQAVDMTES 494 >gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] Length = 534 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 +GQDFELIPFGAGRRICPG +FGL MLHLVLAS L AF++ TV DE VDMSES Sbjct: 451 KGQDFELIPFGAGRRICPGLSFGLQMLHLVLASLLQAFDMSTVSDEAVDMSES 503 >gb|EYU23760.1| hypothetical protein MIMGU_mgv1a026908mg [Mimulus guttatus] Length = 504 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 +GQDFELIPFGAGRRICPG +FG+HMLHLVLA+ L AF++ TV DE VDM+E+ Sbjct: 428 KGQDFELIPFGAGRRICPGTSFGMHMLHLVLANVLQAFDLSTVSDEVVDMAET 480 >gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] Length = 516 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 +GQDFELIPF AGRRICPG NFGL MLHLVLAS L AF++ V +EE+DMSES Sbjct: 439 KGQDFELIPFSAGRRICPGTNFGLQMLHLVLASLLQAFDLSRVSNEEIDMSES 491 >ref|XP_007017404.1| Cytochrome P450 82A3, putative [Theobroma cacao] gi|508722732|gb|EOY14629.1| Cytochrome P450 82A3, putative [Theobroma cacao] Length = 527 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 +GQ FELIPFGAGRR+CPG NFGL M HLVLA LHAF++WT +E VDM+ S Sbjct: 450 KGQHFELIPFGAGRRLCPGINFGLQMTHLVLARLLHAFDIWTPSNEPVDMTGS 502 >gb|EYU23763.1| hypothetical protein MIMGU_mgv1a023100mg [Mimulus guttatus] Length = 529 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/54 (75%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEE-VDMSES 161 RGQDFELIPFGAGRR CPG +FGLHMLHLVLAS L AF++ TV E VDM+ES Sbjct: 452 RGQDFELIPFGAGRRSCPGTSFGLHMLHLVLASLLQAFDLSTVSSNEIVDMTES 505 >ref|XP_004489341.1| PREDICTED: cytochrome P450 82A3-like [Cicer arietinum] Length = 528 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 +GQDFEL+PFG+GRRICPG +FGLHM++L+LA+FLH+FE+ E VDM+E+ Sbjct: 447 KGQDFELLPFGSGRRICPGISFGLHMIYLILANFLHSFEISNGSSEPVDMTEN 499 >ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula] gi|355493360|gb|AES74563.1| Cytochrome P450 [Medicago truncatula] Length = 524 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/53 (64%), Positives = 44/53 (83%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 +GQ FEL+PFG+GRRICPG +FGLHM+HL LA+FLH+FE+ E VDM+E+ Sbjct: 445 KGQHFELLPFGSGRRICPGISFGLHMIHLTLANFLHSFEIVNGSSEPVDMTEN 497 >ref|XP_002510297.1| cytochrome P450, putative [Ricinus communis] gi|223550998|gb|EEF52484.1| cytochrome P450, putative [Ricinus communis] Length = 526 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSE 158 RGQ FELIPFG+GRR CPGA FGLH LHL LA FLHAF++ T D+ +DMSE Sbjct: 445 RGQHFELIPFGSGRRSCPGAPFGLHALHLALARFLHAFDLATPMDQPIDMSE 496 >ref|XP_007151140.1| hypothetical protein PHAVU_004G021100g [Phaseolus vulgaris] gi|561024449|gb|ESW23134.1| hypothetical protein PHAVU_004G021100g [Phaseolus vulgaris] Length = 501 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/53 (62%), Positives = 45/53 (84%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 +GQ FEL+PFG+GRRICPG +FGL+M+HL LA+FLH+FE+ +E +DMSE+ Sbjct: 422 KGQSFELLPFGSGRRICPGISFGLNMIHLTLANFLHSFEILNKPNEPIDMSEA 474 >ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma cacao] gi|508722731|gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma cacao] Length = 527 Score = 79.0 bits (193), Expect = 6e-13 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RGQ FELIPFG+GRR CPGA+F L +LHL LA FLHAFE+ T D+ VDM+ES Sbjct: 449 RGQQFELIPFGSGRRSCPGASFALQLLHLTLARFLHAFELSTPLDQPVDMTES 501 >ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis] Length = 528 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RGQ FELIPFG+GRR CPGA+F L +LHL LA LHAFE+ T D+ VDM+ES Sbjct: 450 RGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTES 502 >ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina] gi|557537012|gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina] Length = 521 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RGQ FELIPFG+GRR CPGA+F L +LHL LA LHAFE+ T D+ VDM+ES Sbjct: 443 RGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTES 495 >ref|XP_002282091.2| PREDICTED: cytochrome P450 82A4-like [Vitis vinifera] Length = 526 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RG+ FE IPFGAGRR CPG FGL +LHL LASFLHAFE T +E+V+M ES Sbjct: 448 RGKHFEFIPFGAGRRACPGITFGLQVLHLTLASFLHAFEFSTPSNEQVNMRES 500 >ref|XP_003618366.1| Cytochrome P450 [Medicago truncatula] gi|355493381|gb|AES74584.1| Cytochrome P450 [Medicago truncatula] Length = 579 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RG FEL+PFG GRRICPG +FGL M+HL LASFLH+FE+ E +DM+E+ Sbjct: 500 RGHHFELLPFGGGRRICPGMSFGLQMVHLTLASFLHSFEILNPSSEPIDMTET 552 >ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris] gi|561009731|gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris] Length = 528 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RGQ+FELIPFG+GRR CPG +F L +LHL LA LHAFE T DE VDM+ES Sbjct: 450 RGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFEFATPSDEPVDMTES 502 >ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis] gi|223550999|gb|EEF52485.1| cytochrome P450, putative [Ricinus communis] Length = 523 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSE 158 RG FEL+PFG+GRR CPGA+F LH LHL LA FLHAF+V T D+ VDM+E Sbjct: 445 RGHHFELLPFGSGRRSCPGASFALHALHLTLARFLHAFDVATPMDQPVDMTE 496 >ref|XP_003554859.1| PREDICTED: cytochrome P450 82A4-like [Glycine max] Length = 528 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSES 161 RG FEL+PFG+GRRICPG +FGL MLH LASFLH+FE+ E +DM+ES Sbjct: 449 RGHHFELLPFGSGRRICPGISFGLRMLHFPLASFLHSFEILNPSTEPLDMTES 501 >emb|CBI19610.3| unnamed protein product [Vitis vinifera] Length = 933 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = +3 Query: 3 RGQDFELIPFGAGRRICPGANFGLHMLHLVLASFLHAFEVWTVGDEEVDMSE 158 RGQ F+L+PFGAGRR CPG F L MLHL LASFLH FEV T + VDMSE Sbjct: 856 RGQHFQLLPFGAGRRSCPGITFALQMLHLALASFLHGFEVSTPSNAPVDMSE 907