BLASTX nr result
ID: Mentha27_contig00003705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00003705 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20883.1| hypothetical protein MIMGU_mgv1a011564mg [Mimulus... 67 3e-09 gb|EYU20882.1| hypothetical protein MIMGU_mgv1a011564mg [Mimulus... 67 3e-09 gb|EYU30340.1| hypothetical protein MIMGU_mgv1a011487mg [Mimulus... 64 2e-08 gb|EPS60046.1| hypothetical protein M569_14758, partial [Genlise... 64 2e-08 ref|XP_004287214.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 62 1e-07 ref|XP_002530947.1| NADH-cytochrome B5 reductase, putative [Rici... 62 1e-07 ref|XP_002873852.1| hypothetical protein ARALYDRAFT_909780 [Arab... 61 2e-07 ref|XP_002319200.1| hypothetical protein POPTR_0013s06360g [Popu... 61 2e-07 gb|AAV69019.1| NADH:cytochrome b5 reductase [Vernicia fordii] gi... 61 2e-07 gb|EXB44362.1| NADH-cytochrome b5 reductase 1 [Morus notabilis] 60 4e-07 ref|XP_006288397.1| hypothetical protein CARUB_v10001654mg [Caps... 60 4e-07 ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Rici... 59 5e-07 ref|NP_197279.1| NADH--cytochrome B5 reductase 1 [Arabidopsis th... 59 7e-07 ref|XP_007161903.1| hypothetical protein PHAVU_001G107300g [Phas... 59 9e-07 ref|XP_006605580.1| PREDICTED: NADH--cytochrome b5 reductase 1 i... 58 1e-06 ref|XP_006437259.1| hypothetical protein CICLE_v10032349mg [Citr... 58 1e-06 ref|XP_006437258.1| hypothetical protein CICLE_v10032349mg [Citr... 58 1e-06 ref|XP_006829810.1| hypothetical protein AMTR_s00119p00071880 [A... 58 1e-06 ref|XP_003556838.1| PREDICTED: NADH--cytochrome b5 reductase 1 i... 58 1e-06 ref|XP_003592232.1| NADH cytochrome b5 reductase [Medicago trunc... 58 1e-06 >gb|EYU20883.1| hypothetical protein MIMGU_mgv1a011564mg [Mimulus guttatus] Length = 273 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVA 351 Y L SSKKPKVCLDSENFKEFKLVKKTQ+SHNVA Sbjct: 26 YILLSSKKPKVCLDSENFKEFKLVKKTQLSHNVA 59 >gb|EYU20882.1| hypothetical protein MIMGU_mgv1a011564mg [Mimulus guttatus] Length = 277 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVA 351 Y L SSKKPKVCLDSENFKEFKLVKKTQ+SHNVA Sbjct: 26 YILLSSKKPKVCLDSENFKEFKLVKKTQLSHNVA 59 >gb|EYU30340.1| hypothetical protein MIMGU_mgv1a011487mg [Mimulus guttatus] Length = 280 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 YFLFSSKKPKVCL+ E FKEFKL KKTQ+SHNVA+ Sbjct: 29 YFLFSSKKPKVCLNPETFKEFKLFKKTQLSHNVAK 63 >gb|EPS60046.1| hypothetical protein M569_14758, partial [Genlisea aurea] Length = 84 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 YFL SSKK KVCLD ENFKEFKLVKKTQ++HNVA+ Sbjct: 27 YFLISSKKSKVCLDPENFKEFKLVKKTQLTHNVAK 61 >ref|XP_004287214.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Fragaria vesca subsp. vesca] Length = 280 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 FLFSSKKPK CLD +NFK+FKLVK+TQ+SHNVA+ Sbjct: 30 FLFSSKKPKGCLDPQNFKDFKLVKRTQLSHNVAK 63 >ref|XP_002530947.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] gi|223529462|gb|EEF31419.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] Length = 258 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 FLFS+KKPK CLD ENFK+FKLVK+TQ+SHNVA+ Sbjct: 30 FLFSAKKPKGCLDPENFKDFKLVKRTQLSHNVAK 63 >ref|XP_002873852.1| hypothetical protein ARALYDRAFT_909780 [Arabidopsis lyrata subsp. lyrata] gi|297319689|gb|EFH50111.1| hypothetical protein ARALYDRAFT_909780 [Arabidopsis lyrata subsp. lyrata] Length = 281 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 YFL SSKK +VCLD ENFKEFKLVKK Q+SHNVA+ Sbjct: 30 YFLTSSKKRRVCLDPENFKEFKLVKKNQLSHNVAK 64 >ref|XP_002319200.1| hypothetical protein POPTR_0013s06360g [Populus trichocarpa] gi|222857576|gb|EEE95123.1| hypothetical protein POPTR_0013s06360g [Populus trichocarpa] Length = 280 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 FLFSSKKPK CLD ENFK+FKLVK+ Q+SHNVA+ Sbjct: 30 FLFSSKKPKGCLDPENFKQFKLVKRVQLSHNVAK 63 >gb|AAV69019.1| NADH:cytochrome b5 reductase [Vernicia fordii] gi|55979115|gb|AAV69021.1| NADH:cytochrome b5 reductase [Vernicia fordii] Length = 280 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 FLFSSKKPK CLD ENFK+FKLV +TQ+SHNVA+ Sbjct: 30 FLFSSKKPKGCLDPENFKDFKLVNRTQLSHNVAK 63 >gb|EXB44362.1| NADH-cytochrome b5 reductase 1 [Morus notabilis] Length = 278 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 FLFSS+K K CLD ENFKEFKLVK+TQ+SHNVA+ Sbjct: 28 FLFSSRKAKGCLDPENFKEFKLVKRTQLSHNVAK 61 >ref|XP_006288397.1| hypothetical protein CARUB_v10001654mg [Capsella rubella] gi|482557103|gb|EOA21295.1| hypothetical protein CARUB_v10001654mg [Capsella rubella] Length = 281 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 YF+ SSKK +VCLD ENFKEFKLVKK Q+SHNVA+ Sbjct: 30 YFISSSKKRRVCLDPENFKEFKLVKKDQLSHNVAK 64 >ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] gi|223533062|gb|EEF34822.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] Length = 279 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVA 351 YF +SKKPK CLD ENFKEFKLVK+T++SHNVA Sbjct: 28 YFYLTSKKPKGCLDPENFKEFKLVKRTELSHNVA 61 >ref|NP_197279.1| NADH--cytochrome B5 reductase 1 [Arabidopsis thaliana] gi|75274821|sp|Q9ZNT1.1|NB5R1_ARATH RecName: Full=NADH--cytochrome b5 reductase 1 gi|4240116|dbj|BAA74837.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|4240118|dbj|BAA74838.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|9759054|dbj|BAB09576.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|21553853|gb|AAM62946.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|222423046|dbj|BAH19505.1| AT5G17770 [Arabidopsis thaliana] gi|332005083|gb|AED92466.1| NADH--cytochrome B5 reductase 1 [Arabidopsis thaliana] Length = 281 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 YFL SSKK +VCLD ENFKEFKLVK+ Q+SHNVA+ Sbjct: 30 YFLTSSKKRRVCLDPENFKEFKLVKRHQLSHNVAK 64 >ref|XP_007161903.1| hypothetical protein PHAVU_001G107300g [Phaseolus vulgaris] gi|561035367|gb|ESW33897.1| hypothetical protein PHAVU_001G107300g [Phaseolus vulgaris] Length = 278 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 FLFSSKK K CLD ENFKEFKLVK+ Q+SHNVA+ Sbjct: 28 FLFSSKKRKGCLDPENFKEFKLVKRAQLSHNVAK 61 >ref|XP_006605580.1| PREDICTED: NADH--cytochrome b5 reductase 1 isoform X2 [Glycine max] Length = 280 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVA 351 Y+ + +KKPK CLD ENFKEFKLVK+TQ+SHNVA Sbjct: 27 YYYYVTKKPKGCLDPENFKEFKLVKRTQLSHNVA 60 >ref|XP_006437259.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] gi|568862667|ref|XP_006484798.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Citrus sinensis] gi|557539455|gb|ESR50499.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] Length = 280 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 +L+SSKKPKV LD ENFKEFKLVK+ Q+SHNVA+ Sbjct: 30 YLYSSKKPKVSLDPENFKEFKLVKRLQLSHNVAK 63 >ref|XP_006437258.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] gi|557539454|gb|ESR50498.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] Length = 261 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 +L+SSKKPKV LD ENFKEFKLVK+ Q+SHNVA+ Sbjct: 30 YLYSSKKPKVSLDPENFKEFKLVKRLQLSHNVAK 63 >ref|XP_006829810.1| hypothetical protein AMTR_s00119p00071880 [Amborella trichopoda] gi|548835391|gb|ERM97226.1| hypothetical protein AMTR_s00119p00071880 [Amborella trichopoda] Length = 277 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 253 FLFSSKKPKVCLDSENFKEFKLVKKTQISHNVAR 354 +L+ SKKPK CLD ENF++FKLVKKTQ+SHNVA+ Sbjct: 27 YLYLSKKPKGCLDPENFRDFKLVKKTQLSHNVAK 60 >ref|XP_003556838.1| PREDICTED: NADH--cytochrome b5 reductase 1 isoform X1 [Glycine max] Length = 278 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVA 351 Y+ + +KKPK CLD ENFKEFKLVK+TQ+SHNVA Sbjct: 27 YYYYVTKKPKGCLDPENFKEFKLVKRTQLSHNVA 60 >ref|XP_003592232.1| NADH cytochrome b5 reductase [Medicago truncatula] gi|357462095|ref|XP_003601329.1| NADH cytochrome b5 reductase [Medicago truncatula] gi|355481280|gb|AES62483.1| NADH cytochrome b5 reductase [Medicago truncatula] gi|355490377|gb|AES71580.1| NADH cytochrome b5 reductase [Medicago truncatula] Length = 278 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 250 YFLFSSKKPKVCLDSENFKEFKLVKKTQISHNVA 351 Y+ + +KKPK CLD ENFKEFKLVK+TQ+SHNVA Sbjct: 27 YYYYLTKKPKGCLDPENFKEFKLVKRTQLSHNVA 60