BLASTX nr result
ID: Mentha27_contig00002444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00002444 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45393.1| hypothetical protein MIMGU_mgv1a021519mg [Mimulus... 94 2e-17 gb|EYU34793.1| hypothetical protein MIMGU_mgv1a021590mg [Mimulus... 94 3e-17 ref|XP_003553918.1| PREDICTED: probable calcium-binding protein ... 92 6e-17 gb|EYU34794.1| hypothetical protein MIMGU_mgv1a015890mg [Mimulus... 91 1e-16 ref|XP_002264640.1| PREDICTED: probable calcium-binding protein ... 91 2e-16 emb|CAN80081.1| hypothetical protein VITISV_011291 [Vitis vinifera] 91 2e-16 ref|XP_006599038.1| PREDICTED: putative calcium-binding protein ... 90 3e-16 emb|CBI27598.3| unnamed protein product [Vitis vinifera] 90 3e-16 ref|XP_002263765.1| PREDICTED: probable calcium-binding protein ... 90 3e-16 emb|CAN78147.1| hypothetical protein VITISV_039879 [Vitis vinifera] 90 3e-16 ref|XP_007151537.1| hypothetical protein PHAVU_004G055200g [Phas... 90 4e-16 emb|CBI27594.3| unnamed protein product [Vitis vinifera] 89 5e-16 ref|XP_002264877.1| PREDICTED: probable calcium-binding protein ... 89 5e-16 emb|CBI27601.3| unnamed protein product [Vitis vinifera] 88 1e-15 ref|XP_002264326.1| PREDICTED: probable calcium-binding protein ... 88 1e-15 gb|EPS67292.1| hypothetical protein M569_07485, partial [Genlise... 88 1e-15 ref|XP_002264501.1| PREDICTED: probable calcium-binding protein ... 88 1e-15 emb|CAN78146.1| hypothetical protein VITISV_039878 [Vitis vinifera] 88 1e-15 ref|XP_004305915.1| PREDICTED: uncharacterized protein LOC101293... 87 2e-15 ref|XP_006447105.1| hypothetical protein CICLE_v10018267mg [Citr... 87 2e-15 >gb|EYU45393.1| hypothetical protein MIMGU_mgv1a021519mg [Mimulus guttatus] Length = 138 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AFK+YEMEGSGCITP SL+R LSRLGERR VD+C MIA +DLN DGVL FDEFK MM Sbjct: 80 AFKMYEMEGSGCITPKSLKRMLSRLGERRDVDECTGMIARFDLNGDGVLNFDEFKEMM 137 >gb|EYU34793.1| hypothetical protein MIMGU_mgv1a021590mg [Mimulus guttatus] Length = 142 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/60 (70%), Positives = 53/60 (88%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMMTS 104 AFK+YEMEGSGCITP SL+R LS+LG+R +VDQC +MIA +D+N DGVL FDEFK+MM++ Sbjct: 82 AFKLYEMEGSGCITPESLKRMLSKLGQRSTVDQCRNMIARFDINGDGVLNFDEFKVMMSA 141 >ref|XP_003553918.1| PREDICTED: probable calcium-binding protein CML31-like [Glycine max] Length = 140 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AFK+YEM+GSGCITP SL+R LSRLGE RS+D+C MIA +DL+ DGVLTFDEFK+MM Sbjct: 82 AFKMYEMDGSGCITPRSLKRMLSRLGESRSIDECKVMIARFDLDGDGVLTFDEFKVMM 139 >gb|EYU34794.1| hypothetical protein MIMGU_mgv1a015890mg [Mimulus guttatus] Length = 142 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMMTS 104 AF +YE+EG GCITP SL+R LSRLG++RSVD+C +MIA +DLN DGVL FDEFK+MM+S Sbjct: 82 AFGMYELEGRGCITPESLKRMLSRLGQQRSVDECKNMIARFDLNGDGVLNFDEFKVMMSS 141 >ref|XP_002264640.1| PREDICTED: probable calcium-binding protein CML31-like [Vitis vinifera] Length = 140 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCITP SL+R LSRLGE RSV++C MI +D+N DGVL+FDEFKLMM Sbjct: 82 AFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVMIRQFDVNGDGVLSFDEFKLMM 139 >emb|CAN80081.1| hypothetical protein VITISV_011291 [Vitis vinifera] Length = 140 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCITP SL+R LSRLGE RSV++C MIA +D N DGVL+FDEFKLM+ Sbjct: 82 AFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVMIAQFDXNGDGVLSFDEFKLML 139 >ref|XP_006599038.1| PREDICTED: putative calcium-binding protein CML23-like [Glycine max] Length = 140 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AFK YEM+GSGCITP SL+R LSRLGE RS+D+C MIA +DL+ DGVLTFDEFK+MM Sbjct: 82 AFKRYEMDGSGCITPRSLKRMLSRLGESRSLDECKVMIARFDLDGDGVLTFDEFKVMM 139 >emb|CBI27598.3| unnamed protein product [Vitis vinifera] Length = 108 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCIT SL+R LSRLGE RSV++CG MI +D+N DGVL+FDEFKLMM Sbjct: 50 AFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECGVMIGQFDVNGDGVLSFDEFKLMM 107 >ref|XP_002263765.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera] Length = 140 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCIT SL+R LSRLGE RSV++CG MI +D+N DGVL+FDEFKLMM Sbjct: 82 AFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECGVMIGQFDVNGDGVLSFDEFKLMM 139 >emb|CAN78147.1| hypothetical protein VITISV_039879 [Vitis vinifera] Length = 129 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCITP SL+R LSRLGE RSV++C MI +D+N DGVL+FDEFKLMM Sbjct: 71 AFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVMIREFDVNGDGVLSFDEFKLMM 128 >ref|XP_007151537.1| hypothetical protein PHAVU_004G055200g [Phaseolus vulgaris] gi|561024846|gb|ESW23531.1| hypothetical protein PHAVU_004G055200g [Phaseolus vulgaris] Length = 141 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AFK+YEMEG GCITP SL+R L RLGE +S+D+C MIA +DLN DGVLTFDEF++MM Sbjct: 83 AFKMYEMEGCGCITPKSLKRMLGRLGECKSIDECQGMIARFDLNGDGVLTFDEFRVMM 140 >emb|CBI27594.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/58 (70%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF +YEM+GSGCITP SL+R LSRLGE RSV++CG M+ +D+N DGVL+FDEFKLMM Sbjct: 45 AFGMYEMDGSGCITPKSLKRMLSRLGESRSVEECGVMLRQFDVNGDGVLSFDEFKLMM 102 >ref|XP_002264877.1| PREDICTED: probable calcium-binding protein CML31-like [Vitis vinifera] Length = 140 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/58 (70%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF +YEM+GSGCITP SL+R LSRLGE RSV++CG M+ +D+N DGVL+FDEFKLMM Sbjct: 82 AFGMYEMDGSGCITPKSLKRMLSRLGESRSVEECGVMLRQFDVNGDGVLSFDEFKLMM 139 >emb|CBI27601.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCITP SL+R LSRLGE RSV++C +I +D+N DGVL+FDEFKLM+ Sbjct: 39 AFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVIIGQFDVNGDGVLSFDEFKLML 96 >ref|XP_002264326.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera] Length = 140 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCITP SL+R LSRLGE RSV++C +I +D+N DGVL+FDEFKLM+ Sbjct: 82 AFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVIIGQFDVNGDGVLSFDEFKLML 139 >gb|EPS67292.1| hypothetical protein M569_07485, partial [Genlisea aurea] Length = 146 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSG IT SLRR LSRLGERR+V QC +MIA +DLN DGVL+FDEFK MM Sbjct: 89 AFRMYEMEGSGIITAKSLRRMLSRLGERRTVHQCRNMIARFDLNGDGVLSFDEFKAMM 146 >ref|XP_002264501.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera] Length = 140 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCIT SL+R LSRLGE RSV++C MI +D+N DGVL+FDEFKLMM Sbjct: 82 AFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECSVMIGQFDVNGDGVLSFDEFKLMM 139 >emb|CAN78146.1| hypothetical protein VITISV_039878 [Vitis vinifera] Length = 135 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AF++YEMEGSGCIT SL+R LSRLGE RSV++C MI +D+N DGVL+FDEFKLMM Sbjct: 77 AFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECSVMIGQFDVNGDGVLSFDEFKLMM 134 >ref|XP_004305915.1| PREDICTED: uncharacterized protein LOC101293333 [Fragaria vesca subsp. vesca] Length = 407 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMM 110 AFK+Y+ +G GCITP SL+R LSRLGE RSVD+C MIA +DLN DGVL FDEFK+MM Sbjct: 349 AFKMYDTDGCGCITPKSLKRMLSRLGESRSVDECKVMIAKFDLNGDGVLNFDEFKVMM 406 >ref|XP_006447105.1| hypothetical protein CICLE_v10018267mg [Citrus clementina] gi|568831558|ref|XP_006470029.1| PREDICTED: calcium-binding protein CML38-like [Citrus sinensis] gi|557549716|gb|ESR60345.1| hypothetical protein CICLE_v10018267mg [Citrus clementina] Length = 141 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = -3 Query: 283 AFKIYEMEGSGCITPTSLRRTLSRLGERRSVDQCGDMIACYDLNADGVLTFDEFKLMMT 107 AFK+YEM+G GCITP SL+R LSRLG+ +S D+C MIA +DLN DGVL FDEF++MM+ Sbjct: 83 AFKMYEMDGCGCITPKSLKRMLSRLGQSKSDDECKSMIAYFDLNGDGVLNFDEFRIMMS 141