BLASTX nr result
ID: Mentha27_contig00002020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00002020 (775 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34830.1| hypothetical protein MIMGU_mgv1a002265mg [Mimulus... 57 7e-06 >gb|EYU34830.1| hypothetical protein MIMGU_mgv1a002265mg [Mimulus guttatus] Length = 693 Score = 57.0 bits (136), Expect = 7e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 614 ELKDKIKAEAASSQFVRVPYHSHYAPPTFSMDDFE 718 ELKDKIKAEA SSQFV VPY+S+ P+FSMDDFE Sbjct: 544 ELKDKIKAEAESSQFVHVPYYSYEDTPSFSMDDFE 578