BLASTX nr result
ID: Mentha27_contig00002017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00002017 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC29934.1| Photosystem I reaction center subunit XI [Morus n... 57 2e-06 >gb|EXC29934.1| Photosystem I reaction center subunit XI [Morus notabilis] Length = 218 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 104 LLNPKGISGTPLRVLPSTRTSSFTIKAIQSEKPT 3 LL+PKG+S +PLRVLPS R SSFT+KA+QSEKPT Sbjct: 24 LLSPKGLSASPLRVLPSRRPSSFTVKAVQSEKPT 57