BLASTX nr result
ID: Mentha27_contig00001479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00001479 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR92329.1| putative metallothionin 2a [Salvia miltiorrhiza] 65 1e-08 gb|AAG50080.1|AF333385_1 class I type 2 metallothionein [Avicenn... 63 5e-08 gb|EYU41724.1| hypothetical protein MIMGU_mgv1a017340mg [Mimulus... 62 8e-08 emb|CAC39481.2| metallothionein-like protein [Quercus suber] 58 1e-06 gb|AGI02569.1| metallothionein 2 [Plantago ovata] 57 2e-06 gb|AFP93964.1| metallothionein type 2 [Ilex paraguariensis] 57 3e-06 gb|ABK59915.1| type-2 metallothionein [Aegiceras corniculatum] 57 3e-06 gb|AFK41306.1| unknown [Lotus japonicus] gi|388508324|gb|AFK4222... 56 5e-06 dbj|BAD18374.1| type 1 metallothionein [Vigna radiata var. radiata] 56 6e-06 gb|ABD97257.1| metallothionin 1 [Camellia sinensis] 56 6e-06 emb|CAB77242.1| metallothionein-like protein type 2 [Persea amer... 55 8e-06 gb|ABD97258.1| metallothionin 2 [Camellia sinensis] 55 8e-06 >gb|ABR92329.1| putative metallothionin 2a [Salvia miltiorrhiza] Length = 80 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 FEGSE MGE ENGCKCGANCTCDPCNCK Sbjct: 52 FEGSEMGMGEDENGCKCGANCTCDPCNCK 80 >gb|AAG50080.1|AF333385_1 class I type 2 metallothionein [Avicennia marina] gi|148372314|gb|ABQ63078.1| class I type 2 metallothionein [Avicennia marina] Length = 79 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 +EG+ESV G AENGCKCGANCTC+PCNCK Sbjct: 51 YEGAESVEGAAENGCKCGANCTCNPCNCK 79 >gb|EYU41724.1| hypothetical protein MIMGU_mgv1a017340mg [Mimulus guttatus] Length = 80 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 F GSE+VMG +ENGCKCGANCTCDPC CK Sbjct: 52 FGGSETVMGGSENGCKCGANCTCDPCTCK 80 >emb|CAC39481.2| metallothionein-like protein [Quercus suber] Length = 77 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 FEGSE +G AENGCKCG+NCTCDPCNCK Sbjct: 50 FEGSEMGVG-AENGCKCGSNCTCDPCNCK 77 >gb|AGI02569.1| metallothionein 2 [Plantago ovata] Length = 81 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 FEG+ESV+ +ENGCKCG NC+C+PCNCK Sbjct: 53 FEGTESVVAGSENGCKCGDNCSCNPCNCK 81 >gb|AFP93964.1| metallothionein type 2 [Ilex paraguariensis] Length = 78 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 FEGSE +G AENGCKCG NCTCDPCNCK Sbjct: 51 FEGSEMGVG-AENGCKCGDNCTCDPCNCK 78 >gb|ABK59915.1| type-2 metallothionein [Aegiceras corniculatum] Length = 79 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 FEGSE+ +G AENGCKCG NCTC+PCNCK Sbjct: 52 FEGSEASVG-AENGCKCGPNCTCNPCNCK 79 >gb|AFK41306.1| unknown [Lotus japonicus] gi|388508324|gb|AFK42228.1| unknown [Lotus japonicus] Length = 74 Score = 56.2 bits (134), Expect = 5e-06 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 FEG+E +G +NGCKCG++CTCDPCNCK Sbjct: 46 FEGAEMGVGAEDNGCKCGSDCTCDPCNCK 74 >dbj|BAD18374.1| type 1 metallothionein [Vigna radiata var. radiata] Length = 73 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 FEG+E + +NGCKCG+NCTCDPCNCK Sbjct: 45 FEGAEMGVAAEDNGCKCGSNCTCDPCNCK 73 >gb|ABD97257.1| metallothionin 1 [Camellia sinensis] Length = 78 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 26/30 (86%), Gaps = 1/30 (3%) Frame = -1 Query: 419 FEGSESVMGEA-ENGCKCGANCTCDPCNCK 333 FEG+E MGEA ENGCKCGANCTCDPC CK Sbjct: 51 FEGTE--MGEAAENGCKCGANCTCDPCTCK 78 >emb|CAB77242.1| metallothionein-like protein type 2 [Persea americana] Length = 76 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 F+G+E G AENGCKCG+NCTCDPCNCK Sbjct: 49 FDGAEMEAG-AENGCKCGSNCTCDPCNCK 76 >gb|ABD97258.1| metallothionin 2 [Camellia sinensis] Length = 78 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 419 FEGSESVMGEAENGCKCGANCTCDPCNCK 333 FEGSE +G AENGCKCGANC+CDPC CK Sbjct: 51 FEGSEMGVG-AENGCKCGANCSCDPCTCK 78