BLASTX nr result
ID: Mentha27_contig00001357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00001357 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006829488.1| hypothetical protein AMTR_s00074p00097250 [A... 56 6e-06 >ref|XP_006829488.1| hypothetical protein AMTR_s00074p00097250 [Amborella trichopoda] gi|548834972|gb|ERM96904.1| hypothetical protein AMTR_s00074p00097250 [Amborella trichopoda] Length = 291 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/59 (55%), Positives = 34/59 (57%) Frame = +2 Query: 2 RNCVKIRTPTQVANHAQKYFLXXXXXXXXXXXSSFFDITTDAMLCLTE*ITEETVFDQE 178 RN VK RTPTQVA+HAQKYFL SS FDITTD L L EETV E Sbjct: 125 RNFVKTRTPTQVASHAQKYFLRRTNLSRRRRRSSLFDITTDTFLSLP--AEEETVIAAE 181