BLASTX nr result
ID: Mentha27_contig00001278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00001278 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006573382.1| PREDICTED: gamma-interferon-inducible lysoso... 68 2e-09 ref|XP_003516977.1| PREDICTED: gamma-interferon-inducible lysoso... 68 2e-09 ref|XP_002526664.1| Gamma-interferon-inducible lysosomal thiol r... 67 2e-09 ref|XP_006576222.1| PREDICTED: uncharacterized protein LOC100784... 67 3e-09 ref|NP_001239975.1| uncharacterized protein LOC100784702 [Glycin... 67 3e-09 ref|XP_004148608.1| PREDICTED: gamma-interferon-inducible lysoso... 65 8e-09 ref|XP_002323009.1| gamma interferon responsive lysosomal thiol ... 65 8e-09 gb|EYU26691.1| hypothetical protein MIMGU_mgv1a010676mg [Mimulus... 65 1e-08 gb|EPS59926.1| hypothetical protein M569_14879, partial [Genlise... 65 1e-08 ref|XP_006492565.1| PREDICTED: uncharacterized protein LOC102627... 64 2e-08 ref|XP_006359552.1| PREDICTED: gamma-interferon-inducible lysoso... 64 2e-08 ref|XP_007134663.1| hypothetical protein PHAVU_010G065800g [Phas... 63 4e-08 ref|XP_006481419.1| PREDICTED: gamma-interferon-inducible lysoso... 62 6e-08 ref|XP_004246265.1| PREDICTED: gamma-interferon-inducible lysoso... 62 8e-08 gb|AAF82212.1|AC067971_20 Contains similarity to an unknown prot... 62 8e-08 ref|NP_563779.1| GILT domain-containing protein [Arabidopsis tha... 62 8e-08 ref|NP_195778.1| protein OAS HIGH ACCUMULATION 1 [Arabidopsis th... 62 1e-07 ref|XP_006425132.1| hypothetical protein CICLE_v10029177mg [Citr... 60 2e-07 ref|XP_003604571.1| Gamma-interferon-inducible lysosomal thiol r... 60 3e-07 ref|XP_006488571.1| PREDICTED: gamma-interferon-inducible lysoso... 60 4e-07 >ref|XP_006573382.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform X2 [Glycine max] Length = 241 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY 126 HRFVP VV NN LQED+QNF+ Y+CRAYKGN +PNAC + TR Y Sbjct: 160 HRFVPWVVVNNQALQEDYQNFVTYICRAYKGNVIPNACR--SLSTRTY 205 >ref|XP_003516977.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform X1 [Glycine max] Length = 263 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY 126 HRFVP VV NN LQED+QNF+ Y+CRAYKGN +PNAC + TR Y Sbjct: 182 HRFVPWVVVNNQALQEDYQNFVTYICRAYKGNVIPNACR--SLSTRTY 227 >ref|XP_002526664.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, putative [Ricinus communis] gi|223533964|gb|EEF35686.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, putative [Ricinus communis] Length = 251 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/60 (53%), Positives = 38/60 (63%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY*HK*RTSIPAFS 90 HRFVP VV NN PLQEDF+NF+ Y CRAY G ++P ACT ET + TS F+ Sbjct: 171 HRFVPWVVVNNQPLQEDFENFVSYACRAYTGTQVPEACTSLPAETNSLLKENHTSPVCFA 230 >ref|XP_006576222.1| PREDICTED: uncharacterized protein LOC100784702 isoform X1 [Glycine max] Length = 262 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNAC 156 HRFVP VV NN LQED+QNF+ Y+CRAYKGN +PNAC Sbjct: 183 HRFVPWVVVNNQALQEDYQNFVTYICRAYKGNVIPNAC 220 >ref|NP_001239975.1| uncharacterized protein LOC100784702 [Glycine max] gi|255642451|gb|ACU21489.1| unknown [Glycine max] Length = 184 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNAC 156 HRFVP VV NN LQED+QNF+ Y+CRAYKGN +PNAC Sbjct: 105 HRFVPWVVVNNQALQEDYQNFVTYICRAYKGNVIPNAC 142 >ref|XP_004148608.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Cucumis sativus] gi|449519974|ref|XP_004167009.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Cucumis sativus] Length = 238 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY 126 HRFVP V+ +N PLQED+QNF+ Y+C+AYKG+ +P AC ++ R Y Sbjct: 170 HRFVPWVIVDNHPLQEDYQNFMAYICKAYKGSAVPEACKSINLKNRQY 217 >ref|XP_002323009.1| gamma interferon responsive lysosomal thiol reductase family protein [Populus trichocarpa] gi|118482314|gb|ABK93083.1| unknown [Populus trichocarpa] gi|222867639|gb|EEF04770.1| gamma interferon responsive lysosomal thiol reductase family protein [Populus trichocarpa] Length = 242 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNAC 156 HRFVP VV NN PL+EDF+NF+ YVC+AY+G K+P AC Sbjct: 169 HRFVPWVVVNNQPLREDFENFVSYVCKAYRGTKIPEAC 206 >gb|EYU26691.1| hypothetical protein MIMGU_mgv1a010676mg [Mimulus guttatus] Length = 305 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -3 Query: 272 RHRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGN-KLPNACTH*EVET 135 RH+FVP V+ NN PLQ+D+QNF+GY+C+AY+G K PNAC + T Sbjct: 239 RHKFVPWVLVNNFPLQQDYQNFVGYICKAYRGGYKKPNACKSSTIST 285 >gb|EPS59926.1| hypothetical protein M569_14879, partial [Genlisea aurea] Length = 200 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH 150 HRFVP VV + +PLQ+D+QNFI Y+C+AYKG+ LP+AC + Sbjct: 147 HRFVPWVVVDGLPLQQDYQNFISYICKAYKGSSLPSACAN 186 >ref|XP_006492565.1| PREDICTED: uncharacterized protein LOC102627819 isoform X1 [Citrus sinensis] Length = 108 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY 126 H++VP VV + PL ED++NFIGY+C+AYKGN +P AC + + T HY Sbjct: 26 HQYVPWVVVDGQPLNEDYENFIGYICKAYKGNVVPKACGNLSLITSHY 73 >ref|XP_006359552.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Solanum tuberosum] Length = 230 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNAC 156 HRFVP V+ NN PLQED+QNFI Y+C+AYKG+ P AC Sbjct: 171 HRFVPWVLVNNQPLQEDYQNFIAYICKAYKGHNKPQAC 208 >ref|XP_007134663.1| hypothetical protein PHAVU_010G065800g [Phaseolus vulgaris] gi|561007708|gb|ESW06657.1| hypothetical protein PHAVU_010G065800g [Phaseolus vulgaris] Length = 266 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY 126 HRFVP VV NN LQED++NF+ Y+CRAYKG +P+AC + R Y Sbjct: 186 HRFVPWVVVNNQALQEDYRNFVTYICRAYKGQVIPSACRSSSLSARTY 233 >ref|XP_006481419.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Citrus sinensis] Length = 229 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNAC 156 HRFVP VV NN PLQEDF NF +VC+AYKG ++P AC Sbjct: 167 HRFVPWVVVNNQPLQEDFMNFANHVCKAYKGTRVPEAC 204 >ref|XP_004246265.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform 1 [Solanum lycopersicum] Length = 230 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNAC 156 HRFVP ++ NN PLQED+QNFI YVC+AYKG P AC Sbjct: 171 HRFVPWLLVNNQPLQEDYQNFIEYVCKAYKGRNKPQAC 208 >gb|AAF82212.1|AC067971_20 Contains similarity to an unknown protein F7A7_100 gi|7327817 from Arabidopsis thaliana BAC F7A7 gb|AL161946. ESTs gb|N65842, gb|F19836 and gb|AI993679 come from this gene [Arabidopsis thaliana] Length = 262 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACT 153 H++VP VV + PL ED++NFI Y+C+AYKGNK+P ACT Sbjct: 176 HKYVPWVVVDGQPLYEDYENFISYICKAYKGNKVPGACT 214 >ref|NP_563779.1| GILT domain-containing protein [Arabidopsis thaliana] gi|15146334|gb|AAK83650.1| At1g07080/F10K1_15 [Arabidopsis thaliana] gi|15809756|gb|AAL06806.1| At1g07080/F10K1_15 [Arabidopsis thaliana] gi|332189954|gb|AEE28075.1| GILT domain-containing protein [Arabidopsis thaliana] Length = 265 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACT 153 H++VP VV + PL ED++NFI Y+C+AYKGNK+P ACT Sbjct: 179 HKYVPWVVVDGQPLYEDYENFISYICKAYKGNKVPGACT 217 >ref|NP_195778.1| protein OAS HIGH ACCUMULATION 1 [Arabidopsis thaliana] gi|7327817|emb|CAB82274.1| putative protein [Arabidopsis thaliana] gi|332002979|gb|AED90362.1| gamma interferon responsive lysosomal thiol (GILT) reductase family protein [Arabidopsis thaliana] Length = 233 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNAC 156 HRFVP VV NN+PLQE++QNF+ YVC AY N++P AC Sbjct: 165 HRFVPWVVVNNLPLQENYQNFVMYVCNAYGSNQVPEAC 202 >ref|XP_006425132.1| hypothetical protein CICLE_v10029177mg [Citrus clementina] gi|557527066|gb|ESR38372.1| hypothetical protein CICLE_v10029177mg [Citrus clementina] Length = 243 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/48 (47%), Positives = 36/48 (75%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY 126 H++VP VV + PL ED++NF+ Y+C+AYKGN +P AC++ + T +Y Sbjct: 182 HQYVPWVVVDGQPLYEDYENFVSYICKAYKGNVVPKACSNLSLITNYY 229 >ref|XP_003604571.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] gi|355505626|gb|AES86768.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] Length = 261 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY 126 H FVP VV NN LQED+QNF+ Y+C+AYKG+ P+AC V TR Y Sbjct: 184 HTFVPWVVVNNHALQEDYQNFVTYICKAYKGSLKPDACR--SVSTRTY 229 >ref|XP_006488571.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Citrus sinensis] Length = 244 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -3 Query: 269 HRFVPGVVFNNIPLQEDFQNFIGYVCRAYKGNKLPNACTH*EVETRHY 126 H++VP VV PL ED++NFI YVC+AYKGN +P AC++ + T +Y Sbjct: 183 HQYVPWVVVEGQPLYEDYENFISYVCKAYKGNVVPKACSNLFLITNYY 230