BLASTX nr result
ID: Mentha27_contig00000994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00000994 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33110.1| hypothetical protein MIMGU_mgv1a025924mg, partial... 38 7e-07 >gb|EYU33110.1| hypothetical protein MIMGU_mgv1a025924mg, partial [Mimulus guttatus] Length = 386 Score = 37.7 bits (86), Expect(3) = 7e-07 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -2 Query: 307 GFCRPIRFVTINAALFSMAPAVHEGG 230 G +P+RF T NAALFSMAPAV + G Sbjct: 67 GGMKPVRFATFNAALFSMAPAVPDTG 92 Score = 35.8 bits (81), Expect(3) = 7e-07 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = -3 Query: 120 PDPRSATTGEDALSWLQKFARSRLRVSINLSESEI*LK 7 P +A +D L KFA+SRLRVSINL ++EI LK Sbjct: 134 PITTAAMIAQDNLPRQPKFAKSRLRVSINLPDNEISLK 171 Score = 24.3 bits (51), Expect(3) = 7e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 Query: 149 RPRSILKQSPL 117 RP+SILKQSPL Sbjct: 122 RPKSILKQSPL 132