BLASTX nr result
ID: Mentha27_contig00000971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00000971 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18652.1| hypothetical protein MIMGU_mgv1a024363mg [Mimulus... 60 2e-07 >gb|EYU18652.1| hypothetical protein MIMGU_mgv1a024363mg [Mimulus guttatus] Length = 566 Score = 60.5 bits (145), Expect = 2e-07 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = +1 Query: 259 ERERDCNWN*PEFHRYASNYAHRLWWGVYRAMPENLRPY 375 + RDCNW+ PEF RYASN AH++WW V+ +PENL+ + Sbjct: 524 DEARDCNWDWPEFRRYASNTAHKMWWRVHGTLPENLKDF 562