BLASTX nr result
ID: Mentha27_contig00000748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00000748 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305926.2| glutamate decarboxylase 1 family protein [Po... 60 2e-07 gb|AHB63231.1| glutamate decarboxylase 2 [Scutellaria baicalensis] 59 5e-07 >ref|XP_002305926.2| glutamate decarboxylase 1 family protein [Populus trichocarpa] gi|550340527|gb|EEE86437.2| glutamate decarboxylase 1 family protein [Populus trichocarpa] Length = 500 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -3 Query: 241 NEKH-AITIKKTALEVQREITTAWRKMVADKKKMNGVC 131 NE+H A+ +KKTALE QREITT WRK V +KKKMNGVC Sbjct: 463 NEQHGAVVVKKTALETQREITTIWRKFVMEKKKMNGVC 500 >gb|AHB63231.1| glutamate decarboxylase 2 [Scutellaria baicalensis] Length = 497 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 238 EKHAITIKKTALEVQREITTAWRKMVADKKKMNGVC 131 E H IKKT LEVQREIT+AWRKMV++KKK NG+C Sbjct: 462 ETHRAVIKKTTLEVQREITSAWRKMVSEKKKTNGIC 497