BLASTX nr result
ID: Mentha27_contig00000314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00000314 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25857.1| hypothetical protein MIMGU_mgv1a003276mg [Mimulus... 61 1e-07 ref|XP_003550617.1| PREDICTED: uncharacterized protein At1g04910... 59 5e-07 ref|XP_006381630.1| hypothetical protein POPTR_0006s14490g [Popu... 59 7e-07 ref|XP_004157938.1| PREDICTED: DUF246 domain-containing protein ... 59 9e-07 ref|XP_004508243.1| PREDICTED: uncharacterized protein At1g04910... 56 5e-06 >gb|EYU25857.1| hypothetical protein MIMGU_mgv1a003276mg [Mimulus guttatus] Length = 595 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 262 LSQRVNSPRFSGPMTRRAHSFKRNNAQNNN 351 LSQRVNSPRFSGPMTRRAHSFKRNN NNN Sbjct: 23 LSQRVNSPRFSGPMTRRAHSFKRNNNNNNN 52 >ref|XP_003550617.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max] Length = 628 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 262 LSQRVNSPRFSGPMTRRAHSFKRNNAQNNN 351 +SQRVNSPRFSGPMTRRAHSFKRNN+ NN+ Sbjct: 17 VSQRVNSPRFSGPMTRRAHSFKRNNSSNNS 46 >ref|XP_006381630.1| hypothetical protein POPTR_0006s14490g [Populus trichocarpa] gi|550336338|gb|ERP59427.1| hypothetical protein POPTR_0006s14490g [Populus trichocarpa] Length = 648 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 262 LSQRVNSPRFSGPMTRRAHSFKRNNAQNNN 351 +SQRVNSPRFSGPMTRRAHSFKRNN +NN Sbjct: 17 VSQRVNSPRFSGPMTRRAHSFKRNNTSSNN 46 >ref|XP_004157938.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 638 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 262 LSQRVNSPRFSGPMTRRAHSFKRNNAQNNN 351 +SQRVNSPRFSGP+TRRAHSFKRNN NNN Sbjct: 13 VSQRVNSPRFSGPITRRAHSFKRNNNNNNN 42 >ref|XP_004508243.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum] Length = 630 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 262 LSQRVNSPRFSGPMTRRAHSFKRNNAQN 345 +SQRVNSPRFSGPMTRRAHSFKRNN N Sbjct: 19 VSQRVNSPRFSGPMTRRAHSFKRNNTHN 46