BLASTX nr result
ID: Mentha27_contig00000296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00000296 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293277.1| PREDICTED: zinc finger MYND domain-containin... 56 6e-06 ref|XP_006858172.1| hypothetical protein AMTR_s00062p00149800 [A... 55 8e-06 >ref|XP_004293277.1| PREDICTED: zinc finger MYND domain-containing protein 15-like [Fragaria vesca subsp. vesca] Length = 631 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 239 VDVQWPAEISNGSELVAVTVSHPPNQGYQEKS 144 VDVQWP E+SNG +LVAVT+SHPP Q Y+EK+ Sbjct: 220 VDVQWPPEMSNGFDLVAVTISHPPGQAYEEKA 251 >ref|XP_006858172.1| hypothetical protein AMTR_s00062p00149800 [Amborella trichopoda] gi|548862275|gb|ERN19639.1| hypothetical protein AMTR_s00062p00149800 [Amborella trichopoda] Length = 640 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -1 Query: 239 VDVQWPAEISNGSELVAVTVSHPPNQGYQEKSRGES 132 VDVQWP E+ G +LVAVTVSHPPNQ Y EK + S Sbjct: 220 VDVQWPVEMQKGWDLVAVTVSHPPNQAYSEKPKSNS 255