BLASTX nr result
ID: Mentha27_contig00000233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00000233 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28826.1| hypothetical protein MIMGU_mgv1a009546mg [Mimulus... 91 2e-16 >gb|EYU28826.1| hypothetical protein MIMGU_mgv1a009546mg [Mimulus guttatus] Length = 339 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/79 (56%), Positives = 56/79 (70%) Frame = +2 Query: 176 MVQNSINTLVTSRCSVLCGSNDWSRRSSSQVRDSYLLLGASRSCLCAYNGRGASFAGPCK 355 MVQ +INTLVTSRCSV+C S++ RR+ VR+ + +LGA RSCLC+ + ASF GPC Sbjct: 1 MVQVAINTLVTSRCSVVCESSNLWRRNFGVVREHHAVLGAGRSCLCSSVEKDASFVGPCH 60 Query: 356 KFPRSGLRVQAGWLFRGND 412 P LRVQA WLF G+D Sbjct: 61 VSPPRSLRVQARWLFNGSD 79