BLASTX nr result
ID: Mentha27_contig00000092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00000092 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62511.1| hypothetical protein M569_12278, partial [Genlise... 56 6e-06 >gb|EPS62511.1| hypothetical protein M569_12278, partial [Genlisea aurea] Length = 695 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/40 (77%), Positives = 33/40 (82%), Gaps = 6/40 (15%) Frame = -2 Query: 102 DHARSRETLVIGLILRSHLLVLLQSKV------LPFNSRD 1 DH+RS ETLVIGLILRSHLLVLLQSKV LPFNSR+ Sbjct: 545 DHSRSGETLVIGLILRSHLLVLLQSKVDFQHSPLPFNSRN 584