BLASTX nr result
ID: Mentha26_contig00051864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00051864 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25093.1| hypothetical protein MIMGU_mgv1a023721mg, partial... 131 1e-28 >gb|EYU25093.1| hypothetical protein MIMGU_mgv1a023721mg, partial [Mimulus guttatus] Length = 1148 Score = 131 bits (329), Expect = 1e-28 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 2/139 (1%) Frame = -2 Query: 412 EDSKSGMTDCSSSLSIPDSGNAQFKYAPERKKPKHTHN-YNDDEPINDLFPVDPRKLLPD 236 EDSKSG+TDCSSS+S+PDS N QFK ERKKPK+TH YN E NDLF ++P K Sbjct: 731 EDSKSGLTDCSSSVSLPDSENVQFKLESERKKPKYTHKLYNACESPNDLFHMEPLKF--- 787 Query: 235 FQHDLPKVSVSGDSWLSGRAEV-PKSEEFSLSFNEKSLFHIHDIDLGVMRSSCADMMKPF 59 QH+ K+SV +SWLS RAE+ K+E+FSLSFN+ L H D+D +++ K Sbjct: 788 DQHNYSKLSVPCNSWLSERAEISDKTEQFSLSFNDNLLSHSTDVDTDMIK-------KSM 840 Query: 58 DKSSLHDFPLAKGLQLSDK 2 D SSL++FPL KGLQ+ D+ Sbjct: 841 DMSSLNEFPLRKGLQIPDE 859