BLASTX nr result
ID: Mentha26_contig00051800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00051800 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC99303.1| hypothetical protein BAUCODRAFT_104269 [Baudoinia... 56 6e-06 >gb|EMC99303.1| hypothetical protein BAUCODRAFT_104269 [Baudoinia compniacensis UAMH 10762] Length = 654 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -3 Query: 396 ELYHDITVGDNCRTAKCAGPDGVDGFLAYKGWDPVTGLGSPNYPA 262 ++ HDITVG+N + C G GF A KGWDPVTGLG+PNYPA Sbjct: 608 QVLHDITVGNN---SGC----GTSGFFAAKGWDPVTGLGTPNYPA 645