BLASTX nr result
ID: Mentha26_contig00051720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00051720 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30611.1| hypothetical protein MIMGU_mgv1a020771mg [Mimulus... 82 6e-14 ref|XP_004240634.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_002530052.1| pentatricopeptide repeat-containing protein,... 72 8e-11 ref|XP_006364563.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_007227261.1| hypothetical protein PRUPE_ppa017811mg [Prun... 67 3e-09 gb|EXB82495.1| hypothetical protein L484_027670 [Morus notabilis] 66 4e-09 ref|XP_002282301.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_002312667.1| pentatricopeptide repeat-containing family p... 65 7e-09 ref|XP_006483972.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_006438222.1| hypothetical protein CICLE_v10031251mg [Citr... 62 8e-08 ref|NP_172763.1| pentatricopeptide repeat-containing protein [Ar... 60 3e-07 ref|XP_002889980.1| pentatricopeptide repeat-containing protein ... 60 3e-07 ref|XP_006304861.1| hypothetical protein CARUB_v10012598mg [Caps... 60 4e-07 ref|XP_004310156.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_006417164.1| hypothetical protein EUTSA_v10007381mg [Eutr... 58 2e-06 ref|XP_004504137.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >gb|EYU30611.1| hypothetical protein MIMGU_mgv1a020771mg [Mimulus guttatus] Length = 515 Score = 82.4 bits (202), Expect = 6e-14 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 MYKALGKQRLIYRS IASYVKAGLID AIQVFDEMS SDCR+FSV Sbjct: 1 MYKALGKQRLIYRSRIASYVKAGLIDQAIQVFDEMSQSDCRMFSV 45 >ref|XP_004240634.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Solanum lycopersicum] Length = 511 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 MYKALGK RLIYR+ I+SYVK GL++ A+QVFDEM+ SDCR+FS+ Sbjct: 1 MYKALGKHRLIYRTRISSYVKTGLVNEALQVFDEMTQSDCRVFSI 45 >ref|XP_002530052.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530468|gb|EEF32352.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 554 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 MY++LG RLIYRS IA YVKAGLID A+QVFDEMS S+CR+FS+ Sbjct: 1 MYQSLGAHRLIYRSRIAGYVKAGLIDKAVQVFDEMSQSNCRVFSI 45 >ref|XP_006364563.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 511 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 MYKALGK RLIYR+ I++YVK GL++ A+QVFD+M+ SDCR+FS+ Sbjct: 1 MYKALGKHRLIYRTRISNYVKTGLVNEALQVFDKMTQSDCRVFSI 45 >ref|XP_007227261.1| hypothetical protein PRUPE_ppa017811mg [Prunus persica] gi|462424197|gb|EMJ28460.1| hypothetical protein PRUPE_ppa017811mg [Prunus persica] Length = 541 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 MY++LG RLI+RS I YVK GLID A+QVFDEM+ SDCR+FS+ Sbjct: 1 MYRSLGVNRLIFRSRIVYYVKTGLIDQALQVFDEMTRSDCRVFSI 45 >gb|EXB82495.1| hypothetical protein L484_027670 [Morus notabilis] Length = 513 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 M +LG RL+YRS IA VK GLID+A+Q+FDEMSHSDCR+FSV Sbjct: 1 MIHSLGAHRLLYRSRIAYCVKTGLIDHAVQLFDEMSHSDCRVFSV 45 >ref|XP_002282301.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Vitis vinifera] gi|296081374|emb|CBI16807.3| unnamed protein product [Vitis vinifera] Length = 519 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/45 (62%), Positives = 39/45 (86%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 MY++LG+ RL YR+ I+SYVKAGLID A++ FDEM+ S+CR+FS+ Sbjct: 1 MYRSLGRHRLAYRAQISSYVKAGLIDQALKTFDEMTKSNCRVFSI 45 >ref|XP_002312667.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222852487|gb|EEE90034.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 512 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 MY+ LG RLIYR+ IASYVKAGLID A++VFDEM+ S+CR+F + Sbjct: 1 MYQPLGVHRLIYRTRIASYVKAGLIDYAVKVFDEMTLSECRVFGI 45 >ref|XP_006483972.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X1 [Citrus sinensis] gi|568860947|ref|XP_006483973.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X2 [Citrus sinensis] Length = 517 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 M + LG QRLIYR+ I++ VKAGLID A+ VFDEM+ S+CR+FS+ Sbjct: 1 MIQKLGAQRLIYRAQISNLVKAGLIDQAVHVFDEMTQSNCRVFSI 45 >ref|XP_006438222.1| hypothetical protein CICLE_v10031251mg [Citrus clementina] gi|557540418|gb|ESR51462.1| hypothetical protein CICLE_v10031251mg [Citrus clementina] Length = 517 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 M + LG QRLIYR+ I++ VKAGLID A+ VFDEM+ S+CR+FS+ Sbjct: 1 MIQKLGAQRLIYRAQISNLVKAGLIDQAVHVFDEMTQSNCRVFSI 45 >ref|NP_172763.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200670|sp|Q9SAD9.1|PPR40_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g13040, mitochondrial; Flags: Precursor gi|4850387|gb|AAD31057.1|AC007357_6 F3F19.6 [Arabidopsis thaliana] gi|332190841|gb|AEE28962.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 517 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFS 6 M++ LG RL YRS IA+ VK+G+IDNA+QVFDEM HS R+FS Sbjct: 1 MHQTLGAVRLAYRSRIANLVKSGMIDNAVQVFDEMRHSSYRVFS 44 >ref|XP_002889980.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335822|gb|EFH66239.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 517 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFS 6 M++ LG RL YRS IA+ VK+G+IDNA+QVFDEM HS R+FS Sbjct: 1 MHQTLGAVRLAYRSRIANLVKSGMIDNAVQVFDEMRHSSYRVFS 44 >ref|XP_006304861.1| hypothetical protein CARUB_v10012598mg [Capsella rubella] gi|482573572|gb|EOA37759.1| hypothetical protein CARUB_v10012598mg [Capsella rubella] Length = 517 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFS 6 M++ LG RL YRS IA VK+G+IDNA+QVFDEM HS R+FS Sbjct: 1 MHQTLGAVRLAYRSRIAKLVKSGIIDNAVQVFDEMRHSSYRVFS 44 >ref|XP_004310156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 516 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 134 YKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 + LG RLIYRS + YVK GLID+A+ VFDEM+ S+CR+FSV Sbjct: 3 HTTLGAHRLIYRSRMTHYVKTGLIDHALHVFDEMTQSNCRVFSV 46 >ref|XP_006417164.1| hypothetical protein EUTSA_v10007381mg [Eutrema salsugineum] gi|557094935|gb|ESQ35517.1| hypothetical protein EUTSA_v10007381mg [Eutrema salsugineum] Length = 517 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFS 6 M++ LG RL YRS IA VK+G+IDNA+QVFDE+ HS R+FS Sbjct: 1 MHQTLGAVRLAYRSRIAYLVKSGMIDNAVQVFDELRHSSFRVFS 44 >ref|XP_004504137.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Cicer arietinum] Length = 516 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 137 MYKALGKQRLIYRSLIASYVKAGLIDNAIQVFDEMSHSDCRIFSV 3 MY ++ +RL+YRS I+ YVKAGLID AI++FDEMS ++ R FS+ Sbjct: 1 MYHSVAARRLLYRSQISYYVKAGLIDTAIKLFDEMSQTNSRPFSI 45