BLASTX nr result
ID: Mentha26_contig00051698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00051698 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491476.1| PREDICTED: probable F-box protein At3g61730-... 57 4e-06 >ref|XP_006491476.1| PREDICTED: probable F-box protein At3g61730-like [Citrus sinensis] Length = 302 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +2 Query: 173 WTNTDMWCTIASKLDGSDILKLAATSQWFWETLMQQCVWKQAVLHKLRLYD 325 W + D+W IA LDG ++KLA TS+WF + +M CVWK A L L++ D Sbjct: 30 WYDVDIWTYIARFLDGKSLVKLALTSKWFHDVIMHDCVWKFACLRDLQVPD 80