BLASTX nr result
ID: Mentha26_contig00050922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00050922 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44174.1| hypothetical protein MIMGU_mgv1a006296mg [Mimulus... 60 2e-07 >gb|EYU44174.1| hypothetical protein MIMGU_mgv1a006296mg [Mimulus guttatus] Length = 449 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -3 Query: 153 MNYPNWAEIQQNPNPNSEFSVRHAPNHSGGYSQNVVYDPYQPSNVDPHSAL 1 M+Y WAE+QQNPN S + H N+S GYS N DPYQP VDPH+AL Sbjct: 1 MDYARWAEMQQNPN--SGVPLLHTVNYSAGYSHNPNSDPYQPPAVDPHNAL 49