BLASTX nr result
ID: Mentha26_contig00050822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00050822 (513 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242921.1| PREDICTED: probable receptor-like serine/thr... 56 4e-06 >ref|XP_004242921.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like [Solanum lycopersicum] Length = 378 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -1 Query: 156 MRYIRTASLKRLFSLKRHAFDEELPKDSDFTSDQKRASAAAVEPS 22 MRY+RT+SLKRLFS +R +FD ELPK DF ++ A+AA +PS Sbjct: 1 MRYVRTSSLKRLFSFRRQSFDGELPKPCDFNEQEQVAAAATRKPS 45