BLASTX nr result
ID: Mentha26_contig00050590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00050590 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004362281.1| saposin A [Dictyostelium fasciculatum] gi|32... 57 3e-06 >ref|XP_004362281.1| saposin A [Dictyostelium fasciculatum] gi|328876066|gb|EGG24430.1| saposin A [Dictyostelium fasciculatum] Length = 440 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/94 (30%), Positives = 47/94 (50%) Frame = -2 Query: 310 NTECIICTYVVTEIEFLVLNNASLKEIALYVNDTCSSAFLRQYEQVCEKILGYGVIELVD 131 N EC +CT+VV+ E L+ +N +L I ++ C FL +Y C + + E++ Sbjct: 231 NEECAVCTFVVSYAEQLLADNKTLGPIETFLEAECDK-FLPKYASTCNAAISNYLPEIIQ 289 Query: 130 YIRQNQTPAVICGPSELKLCPTAQDAIREGQVIK 29 Y+ QTPA +C E+K C E + +K Sbjct: 290 YLENGQTPAQVC--QEIKFCTAPSAKATEFKYVK 321