BLASTX nr result
ID: Mentha26_contig00050579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00050579 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB39344.1| Putative DUF21 domain-containing protein [Morus n... 57 3e-06 ref|XP_007144609.1| hypothetical protein PHAVU_007G169800g [Phas... 56 5e-06 gb|AAD15341.1| hypothetical protein [Arabidopsis thaliana] gi|72... 56 6e-06 >gb|EXB39344.1| Putative DUF21 domain-containing protein [Morus notabilis] Length = 1282 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/65 (47%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = -2 Query: 286 RLKALDMSFTKVFVSLKELFPQVDARALRAVAIEHRKXXXXXXXXXVEEIIPFFTERSA- 110 RLKAL M F V+ L+E+FPQ+DAR L+AVAIE K + E++P+ T +SA Sbjct: 496 RLKALIMGFKSVYRCLQEVFPQIDARILKAVAIERSKDADAAVDDILTEVLPYMTRQSAF 555 Query: 109 -PNSP 98 NSP Sbjct: 556 LTNSP 560 >ref|XP_007144609.1| hypothetical protein PHAVU_007G169800g [Phaseolus vulgaris] gi|561017799|gb|ESW16603.1| hypothetical protein PHAVU_007G169800g [Phaseolus vulgaris] Length = 667 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -2 Query: 286 RLKALDMSFTKVFVSLKELFPQVDARALRAVAIEHRKXXXXXXXXXVEEIIPFFTER 116 RL L M F V+ SL+ELFPQVD R LRAVAIEH K + E+IPF +++ Sbjct: 48 RLSILIMGFNSVYRSLQELFPQVDGRLLRAVAIEHPKDADLAAGIVLSEVIPFMSKK 104 >gb|AAD15341.1| hypothetical protein [Arabidopsis thaliana] gi|7269773|emb|CAB77773.1| hypothetical protein [Arabidopsis thaliana] Length = 539 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 7/83 (8%) Frame = -2 Query: 268 MSFTKVFVSLKELFPQVDARALRAVAIEHRKXXXXXXXXXVEEIIPFFTERSAPNS---- 101 M + V+ SL ELFPQ+DAR L+AVAIEH K V EI+PFF A +S Sbjct: 1 MGYKAVYRSLTELFPQIDARLLKAVAIEHPKDVNEAAAVVVSEIVPFFYPNLADSSTQPE 60 Query: 100 ---PFNRSVYGEGGSYVSTETLA 41 P N GGSY + ++A Sbjct: 61 NKTPGNVPTEEMGGSYSGSASMA 83