BLASTX nr result
ID: Mentha26_contig00050465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00050465 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66604.1| hypothetical protein L484_024900 [Morus notabilis] 66 6e-09 gb|EXB66084.1| hypothetical protein L484_003885 [Morus notabilis] 66 6e-09 >gb|EXB66604.1| hypothetical protein L484_024900 [Morus notabilis] Length = 147 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/73 (41%), Positives = 45/73 (61%) Frame = +1 Query: 163 PFSDKILYIPLPDRYKVPNIAPYDGLYNPQNFLSRYQYNMINQQLNKIHMCKLFPELLID 342 PF+++I+ PLPD+Y+ P+I PYDG +P + L Y +M+ + MC+ F L D Sbjct: 42 PFTEEIMAPPLPDKYRSPSIPPYDGRGDPDDHLEMYTGHMLLHGYTEEIMCRAFRNHLTD 101 Query: 343 NARRWFDSLPPGS 381 + RRWF +L P S Sbjct: 102 STRRWFRTLRPNS 114 >gb|EXB66084.1| hypothetical protein L484_003885 [Morus notabilis] Length = 288 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/73 (43%), Positives = 44/73 (60%) Frame = +1 Query: 163 PFSDKILYIPLPDRYKVPNIAPYDGLYNPQNFLSRYQYNMINQQLNKIHMCKLFPELLID 342 PF++ I+ +PLPD+YK P I YDG +P + L Y +M+ + MC+ F L D Sbjct: 39 PFTENIIRVPLPDKYKSPPIPLYDGRSDPDDHLEVYTGHMVLHGYPEEIMCRAFRNHLSD 98 Query: 343 NARRWFDSLPPGS 381 +ARRWF SL P S Sbjct: 99 SARRWFRSLKPNS 111