BLASTX nr result
ID: Mentha26_contig00050346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00050346 (895 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Mimulus... 73 2e-10 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-li... 68 5e-09 ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phas... 65 3e-08 ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich re... 65 3e-08 ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich re... 65 5e-08 emb|CBI25352.3| unnamed protein product [Vitis vinifera] 65 5e-08 ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich re... 65 5e-08 ref|NP_001239730.1| probably inactive leucine-rich repeat recept... 64 6e-08 ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich re... 64 1e-07 ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prun... 64 1e-07 ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich re... 63 1e-07 ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich re... 63 1e-07 ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citr... 63 1e-07 ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich re... 62 2e-07 ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich re... 62 2e-07 ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich re... 62 4e-07 ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich re... 61 5e-07 ref|XP_007011288.1| Leucine-rich repeat protein kinase family pr... 61 5e-07 ref|XP_002325929.2| leucine-rich repeat transmembrane protein ki... 60 9e-07 ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich re... 60 1e-06 >gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Mimulus guttatus] Length = 967 Score = 72.8 bits (177), Expect = 2e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -3 Query: 131 LLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 +LF IC +P KSLSPSLNDDVLGLIVFKAD+QDP+GKL SW Sbjct: 9 ILFFICFSPFLAKSLSPSLNDDVLGLIVFKADVQDPDGKLASW 51 >gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 978 Score = 67.8 bits (164), Expect = 5e-09 Identities = 34/55 (61%), Positives = 44/55 (80%) Frame = -3 Query: 167 FLEMRSVVCLVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 FL M+ ++ L L+ + LAP+ V+SL+PSLNDDVLGLIVFKAD+QDP+G L SW Sbjct: 4 FLNMKRLLGLFTLV--VVLAPIYVRSLNPSLNDDVLGLIVFKADVQDPKGMLASW 56 >ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris] gi|561009507|gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris] Length = 954 Score = 65.5 bits (158), Expect = 3e-08 Identities = 33/55 (60%), Positives = 43/55 (78%) Frame = -3 Query: 167 FLEMRSVVCLVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 F M+ + LV+LL +C+A V +++PSLNDDVLGLIVFKADI+DP+GKL SW Sbjct: 5 FSNMKGFLLLVWLLEVVCVA---VAAVNPSLNDDVLGLIVFKADIRDPKGKLASW 56 >ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Solanum lycopersicum] Length = 971 Score = 65.5 bits (158), Expect = 3e-08 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = -3 Query: 164 LEMRSVVCLVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 +EMR V +V L I ++P+SVK+L+ S NDD+LGL+VFKAD+QDP+GKL SW Sbjct: 1 MEMRKVFGIVILC--ILVSPISVKALNLSFNDDILGLMVFKADVQDPQGKLVSW 52 >ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Glycine max] Length = 978 Score = 64.7 bits (156), Expect = 5e-08 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = -3 Query: 167 FLEMRSVVCLVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 F MR + LV+LL +C+A V +++PSLNDDVLGLIVFKADI+DP+GKL SW Sbjct: 5 FSSMRVFLRLVWLLELLCVA---VTAVNPSLNDDVLGLIVFKADIRDPKGKLASW 56 >emb|CBI25352.3| unnamed protein product [Vitis vinifera] Length = 847 Score = 64.7 bits (156), Expect = 5e-08 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -3 Query: 131 LLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 LL + +AP VKSL+PSLNDDVLGLIVFKADIQDP KL SW Sbjct: 8 LLALLVVAPSCVKSLNPSLNDDVLGLIVFKADIQDPNSKLASW 50 >ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Vitis vinifera] Length = 969 Score = 64.7 bits (156), Expect = 5e-08 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -3 Query: 131 LLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 LL + +AP VKSL+PSLNDDVLGLIVFKADIQDP KL SW Sbjct: 8 LLALLVVAPSCVKSLNPSLNDDVLGLIVFKADIQDPNSKLASW 50 >ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like precursor [Glycine max] gi|223452530|gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max] Length = 971 Score = 64.3 bits (155), Expect = 6e-08 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = -3 Query: 158 MRSVVCLVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 MR + LV+LL +C+ SV +++PSLNDDVLGLIVFKADI+DP+GKL SW Sbjct: 1 MRVFLLLVWLLELVCV---SVTAVNPSLNDDVLGLIVFKADIRDPKGKLASW 49 >ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Cicer arietinum] Length = 970 Score = 63.5 bits (153), Expect = 1e-07 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 137 VFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 VFL+ L + V S++PSLNDDVLGLIVFKADIQDP+GKL SW Sbjct: 3 VFLVCLFSLLLVKVSSVNPSLNDDVLGLIVFKADIQDPKGKLTSW 47 >ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica] gi|462416740|gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica] Length = 969 Score = 63.5 bits (153), Expect = 1e-07 Identities = 31/46 (67%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -3 Query: 137 VFLLFSI-CLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 + +LF++ LAP+ +SL+PSLNDDVLGLIVFKADIQDP+GKL +W Sbjct: 4 LLVLFTVFVLAPVLGRSLNPSLNDDVLGLIVFKADIQDPKGKLATW 49 >ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Citrus sinensis] Length = 975 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 131 LLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 LL + LA +SL+PSLNDDVLGLIVFKADIQDP GKL SW Sbjct: 14 LLTFLVLASALTRSLNPSLNDDVLGLIVFKADIQDPNGKLSSW 56 >ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Solanum tuberosum] Length = 971 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/54 (57%), Positives = 42/54 (77%) Frame = -3 Query: 164 LEMRSVVCLVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 +EMR V +V L I ++P+ VK+L+ S NDD+LGL+VFKAD+QDP+GKL SW Sbjct: 1 MEMRKVFGIVILC--ILVSPIFVKALNLSFNDDILGLMVFKADVQDPQGKLVSW 52 >ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina] gi|557538125|gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina] Length = 997 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 131 LLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 LL + LA +SL+PSLNDDVLGLIVFKADIQDP GKL SW Sbjct: 36 LLTFLVLASALTRSLNPSLNDDVLGLIVFKADIQDPNGKLSSW 78 >ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Cucumis sativus] Length = 964 Score = 62.4 bits (150), Expect = 2e-07 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 137 VFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 +F+LF + P+ V+SL+P LN+DVLGLIVFKADI+DPEGKL SW Sbjct: 7 LFVLFVV--VPVLVRSLNPPLNEDVLGLIVFKADIEDPEGKLASW 49 >ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Cucumis sativus] Length = 964 Score = 62.4 bits (150), Expect = 2e-07 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 137 VFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 +F+LF + P+ V+SL+P LN+DVLGLIVFKADI+DPEGKL SW Sbjct: 7 LFVLFVV--VPVLVRSLNPPLNEDVLGLIVFKADIEDPEGKLASW 49 >ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Fragaria vesca subsp. vesca] Length = 969 Score = 61.6 bits (148), Expect = 4e-07 Identities = 31/47 (65%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -3 Query: 140 LVFLLFSICLAPLSV-KSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 L+ LL L+P+ + +SL+PSLNDDVLGLIVFKADIQDP+ KL SW Sbjct: 4 LLLLLAMFALSPILLGRSLNPSLNDDVLGLIVFKADIQDPKAKLGSW 50 >ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Solanum tuberosum] Length = 894 Score = 61.2 bits (147), Expect = 5e-07 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -3 Query: 158 MRSVVCLVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 MR V VFL + + + V++L+PSLNDDVLGLIVFK+D+QDP GKL SW Sbjct: 1 MRKVFVTVFLF--LLVEAVFVEALNPSLNDDVLGLIVFKSDVQDPYGKLKSW 50 >ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma cacao] gi|508728201|gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma cacao] Length = 982 Score = 61.2 bits (147), Expect = 5e-07 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -3 Query: 140 LVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 L+F L + A V+SLSPSLNDDVLGLIVFKADI DP KL SW Sbjct: 17 LLFWLVLLVAASFPVRSLSPSLNDDVLGLIVFKADILDPNQKLSSW 62 >ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550317035|gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 963 Score = 60.5 bits (145), Expect = 9e-07 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -3 Query: 140 LVFLLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 L+ LL + LA V+SL+PSLNDDVLGLIVFKAD+QDP KL SW Sbjct: 7 LLSLLVFLVLAFQCVRSLNPSLNDDVLGLIVFKADLQDPMRKLSSW 52 >ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Citrus sinensis] Length = 967 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -3 Query: 131 LLFSICLAPLSVKSLSPSLNDDVLGLIVFKADIQDPEGKLDSW 3 L+F + LAP+ V+SL P+ NDDVLGLIVFKA ++DP+ KL SW Sbjct: 7 LIFLLVLAPVFVRSLDPTFNDDVLGLIVFKAGLEDPKEKLTSW 49