BLASTX nr result
ID: Mentha26_contig00050191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00050191 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73025.1| hypothetical protein M569_01730, partial [Genlise... 62 8e-08 >gb|EPS73025.1| hypothetical protein M569_01730, partial [Genlisea aurea] Length = 723 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 417 PCSLLRFLKKINLRHWKLLSSIVLCIAVTEAMFAGLGHF 301 P +L F+KKI++R WKLLSSIVLCIA TEAMFA LGHF Sbjct: 249 PVYMLNFVKKIDIRRWKLLSSIVLCIAGTEAMFADLGHF 287