BLASTX nr result
ID: Mentha26_contig00050057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00050057 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33110.1| hypothetical protein MIMGU_mgv1a025924mg, partial... 58 2e-06 >gb|EYU33110.1| hypothetical protein MIMGU_mgv1a025924mg, partial [Mimulus guttatus] Length = 386 Score = 57.8 bits (138), Expect = 2e-06 Identities = 39/69 (56%), Positives = 43/69 (62%), Gaps = 9/69 (13%) Frame = +1 Query: 97 PRRRRSWPKI-VVKKLEKSGSRTQVDSTDG-----ISSAAIHPT-SELGGTRPI*F--IN 249 P RRRS PKI VVKKL KS SRT D D +SSA IHP+ E GG +P+ F N Sbjct: 19 PVRRRSRPKIAVVKKLGKSNSRTHADQKDSPNSTTVSSAVIHPSGGEFGGMKPVRFATFN 78 Query: 250 AVLFSMATA 276 A LFSMA A Sbjct: 79 AALFSMAPA 87