BLASTX nr result
ID: Mentha26_contig00049959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00049959 (536 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003696243.1| PREDICTED: protein NPC2 homolog [Apis florea] 58 2e-06 >ref|XP_003696243.1| PREDICTED: protein NPC2 homolog [Apis florea] Length = 148 Score = 57.8 bits (138), Expect = 2e-06 Identities = 46/142 (32%), Positives = 67/142 (47%), Gaps = 18/142 (12%) Frame = -2 Query: 466 ISALVLVLASIAHAATWVDYKPCDNTKPTPQLVQIDACESHDCTLTRGTPYYMSVDFVAP 287 I V + A + A + D+ PCD KPTP V+I C S C L RGT +VDF A Sbjct: 3 ILTYVYIFAVLFIANSMQDFVPCDG-KPTPTNVKILGCNSLPCNLVRGTNVEANVDFKAV 61 Query: 286 FDTDKV--------------FNITQKPVCGNGL--VCPLYQGSYYS-YAGMWTPMNFTGS 158 +T + + + ++ C N + CPL +G + Y M + Sbjct: 62 ANTKTLKPVVDVDLGNSHMQYPLPEQNACKNLVNGQCPLNKGQAATYYLKMPVLKAYPKV 121 Query: 157 SMT-QFSLVDEKHNTLVCFNLP 95 ++T Q SLVDE +N+ VCF +P Sbjct: 122 ALTIQLSLVDENNNSQVCFKIP 143