BLASTX nr result
ID: Mentha26_contig00049520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00049520 (539 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40115.1| hypothetical protein MIMGU_mgv1a009496mg [Mimulus... 61 2e-07 >gb|EYU40115.1| hypothetical protein MIMGU_mgv1a009496mg [Mimulus guttatus] Length = 340 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/62 (54%), Positives = 40/62 (64%) Frame = +1 Query: 352 SICRRLRQHVAHAIPSTRVRHSSLNSTSTAAFSTIAQTEQEKRGSSTLSKLLLFIPGAIT 531 ++ + LRQ + AIP HSS STS AA S Q EQE + ST SKLLLFIPGA+T Sbjct: 9 TLAKNLRQRLTPAIPPNWAPHSSPISTSAAAISAEPQPEQEIKRRSTWSKLLLFIPGAMT 68 Query: 532 FG 537 FG Sbjct: 69 FG 70