BLASTX nr result
ID: Mentha26_contig00049346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00049346 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39254.1| hypothetical protein MIMGU_mgv1a001708mg [Mimulus... 86 7e-15 ref|XP_002283563.1| PREDICTED: G-type lectin S-receptor-like ser... 79 5e-13 ref|XP_006445636.1| hypothetical protein CICLE_v10014384mg [Citr... 75 7e-12 ref|XP_007014677.1| G-type lectin S-receptor serine/threonine-pr... 75 7e-12 emb|CBI16520.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_006858989.1| hypothetical protein AMTR_s00068p00132090 [A... 69 5e-10 ref|XP_002881807.1| hypothetical protein ARALYDRAFT_903530 [Arab... 65 1e-08 ref|NP_181720.1| G-type lectin S-receptor-like serine/threonine-... 65 1e-08 ref|XP_006295802.1| hypothetical protein CARUB_v10024928mg [Caps... 65 1e-08 ref|XP_006411460.1| hypothetical protein EUTSA_v10016288mg [Eutr... 63 5e-08 ref|XP_002308963.1| curculin-like lectin family protein [Populus... 63 5e-08 ref|XP_002277767.1| PREDICTED: G-type lectin S-receptor-like ser... 62 8e-08 ref|XP_006493922.1| PREDICTED: G-type lectin S-receptor-like ser... 60 3e-07 ref|XP_006349562.1| PREDICTED: G-type lectin S-receptor-like ser... 60 3e-07 gb|EXB53131.1| G-type lectin S-receptor-like serine/threonine-pr... 59 9e-07 ref|XP_006421435.1| hypothetical protein CICLE_v10004371mg [Citr... 59 9e-07 ref|XP_004234895.1| PREDICTED: G-type lectin S-receptor-like ser... 59 9e-07 ref|XP_007028817.1| Curculin-like lectin family protein / PAN do... 58 1e-06 gb|EMT25759.1| Putative serine/threonine-protein kinase receptor... 58 1e-06 ref|XP_002299111.2| hypothetical protein POPTR_0001s04320g [Popu... 58 2e-06 >gb|EYU39254.1| hypothetical protein MIMGU_mgv1a001708mg [Mimulus guttatus] Length = 770 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 325 LEAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPPSR 194 LEA+ERIARISFWCMQ QPF RPSIGEVVKVLEGTLSVDRPPSR Sbjct: 703 LEAIERIARISFWCMQSQPFSRPSIGEVVKVLEGTLSVDRPPSR 746 >ref|XP_002283563.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1-like [Vitis vinifera] Length = 810 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPPSRMGPRQHSGM 167 E +ER+ RI+ WCMQ+QPFLRPSIGEVVKVLEGTLSVD+PPS R+ S M Sbjct: 747 EGVERVVRIALWCMQNQPFLRPSIGEVVKVLEGTLSVDKPPSAFPFRRESRM 798 >ref|XP_006445636.1| hypothetical protein CICLE_v10014384mg [Citrus clementina] gi|557548247|gb|ESR58876.1| hypothetical protein CICLE_v10014384mg [Citrus clementina] Length = 752 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPPSRMGPRQ 179 E +ER RIS WCMQ QPFLRPSIGEVVKVLEGTLSVDRPP R+ Sbjct: 701 EGVERALRISLWCMQSQPFLRPSIGEVVKVLEGTLSVDRPPLNFAFRE 748 >ref|XP_007014677.1| G-type lectin S-receptor serine/threonine-protein kinase SD3-1 [Theobroma cacao] gi|508785040|gb|EOY32296.1| G-type lectin S-receptor serine/threonine-protein kinase SD3-1 [Theobroma cacao] Length = 797 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPPSRMGPRQ 179 E +ER RI+ WC+Q+QPFLRPSIGEVVKVLEG+LSVDRPPS + +Q Sbjct: 749 EKLERAVRIALWCLQNQPFLRPSIGEVVKVLEGSLSVDRPPSNIAFKQ 796 >emb|CBI16520.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPPSRMGPRQHSGM 167 E +E + +I+ CMQ+QPFLRPSIGE VKV+EGTLSVDRPPS RQ S M Sbjct: 66 EGVETVVKIALQCMQNQPFLRPSIGEAVKVIEGTLSVDRPPSAFPFRQESQM 117 >ref|XP_006858989.1| hypothetical protein AMTR_s00068p00132090 [Amborella trichopoda] gi|548863101|gb|ERN20456.1| hypothetical protein AMTR_s00068p00132090 [Amborella trichopoda] Length = 836 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPPS 197 E +ER I+FWC+ HQPFLRPSI EVVKVLEGT SVD PPS Sbjct: 766 EEVERAISIAFWCLHHQPFLRPSISEVVKVLEGTFSVDSPPS 807 >ref|XP_002881807.1| hypothetical protein ARALYDRAFT_903530 [Arabidopsis lyrata subsp. lyrata] gi|297327646|gb|EFH58066.1| hypothetical protein ARALYDRAFT_903530 [Arabidopsis lyrata subsp. lyrata] Length = 760 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 325 LEAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 +E +ER+ RISFWC+Q LRPS+GEVVKVLEGTLSVD PP Sbjct: 696 VEELERVLRISFWCVQMDERLRPSMGEVVKVLEGTLSVDPPP 737 >ref|NP_181720.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1 [Arabidopsis thaliana] gi|75319139|sp|P93756.1|SD31_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1; AltName: Full=S-domain-3 (SD3) receptor kinase 1; Short=SD3-1; Flags: Precursor gi|1871193|gb|AAB63553.1| putative receptor-like protein kinase [Arabidopsis thaliana] gi|20196890|gb|AAM14823.1| putative receptor-like protein kinase [Arabidopsis thaliana] gi|330254951|gb|AEC10045.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1 [Arabidopsis thaliana] Length = 764 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 325 LEAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 +E +ER+ RISFWC+Q LRPS+GEVVKVLEGTLSVD PP Sbjct: 700 VEELERVLRISFWCVQTDERLRPSMGEVVKVLEGTLSVDPPP 741 >ref|XP_006295802.1| hypothetical protein CARUB_v10024928mg [Capsella rubella] gi|482564510|gb|EOA28700.1| hypothetical protein CARUB_v10024928mg [Capsella rubella] Length = 761 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 E +ER+ RISFWC+Q LRPS+GEVVKVLEGTLSVD PP Sbjct: 695 EELERVLRISFWCVQADERLRPSMGEVVKVLEGTLSVDPPP 735 >ref|XP_006411460.1| hypothetical protein EUTSA_v10016288mg [Eutrema salsugineum] gi|557112629|gb|ESQ52913.1| hypothetical protein EUTSA_v10016288mg [Eutrema salsugineum] Length = 762 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 325 LEAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 +E +ER+ RI FWC+Q LRPS+GEVVKVLEGTLSVD PP Sbjct: 695 VEELERVLRILFWCVQADERLRPSMGEVVKVLEGTLSVDPPP 736 >ref|XP_002308963.1| curculin-like lectin family protein [Populus trichocarpa] gi|222854939|gb|EEE92486.1| curculin-like lectin family protein [Populus trichocarpa] Length = 766 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -1 Query: 334 GECLEAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 G L+ +ER+ RI+FWC+Q +RPS+GEVVKVLEGTL+VD PP Sbjct: 697 GVDLKELERLLRIAFWCLQTNEHMRPSMGEVVKVLEGTLTVDPPP 741 >ref|XP_002277767.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1-like [Vitis vinifera] Length = 758 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 E +ER+ R++FWC+Q LRPS+GEVVKV EGTL+VDRPP Sbjct: 697 EEVERLLRLAFWCLQVDKRLRPSMGEVVKVFEGTLTVDRPP 737 >ref|XP_006493922.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1-like [Citrus sinensis] Length = 774 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 E +ER+ RI+FWC+Q+ +RPS+GEV+ VLEGTL+VD PP Sbjct: 707 EKLERVLRIAFWCLQNDERMRPSMGEVLNVLEGTLTVDPPP 747 >ref|XP_006349562.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1-like isoform X1 [Solanum tuberosum] gi|565365748|ref|XP_006349563.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1-like isoform X2 [Solanum tuberosum] gi|565365750|ref|XP_006349564.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1-like isoform X3 [Solanum tuberosum] Length = 759 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 E +ER RI+FWC+Q +RPS+GEV+KVLEGTL+VD PP Sbjct: 696 EELERALRIAFWCLQGDERMRPSMGEVIKVLEGTLTVDPPP 736 >gb|EXB53131.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1 [Morus notabilis] Length = 763 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 334 GECLEAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 G L ++R+ RI+FWC+Q +RPS+ EVVKVLEGTLSVD PP Sbjct: 693 GVDLGELDRVLRIAFWCLQVDERMRPSVREVVKVLEGTLSVDPPP 737 >ref|XP_006421435.1| hypothetical protein CICLE_v10004371mg [Citrus clementina] gi|557523308|gb|ESR34675.1| hypothetical protein CICLE_v10004371mg [Citrus clementina] Length = 774 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -1 Query: 316 MERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 +ER+ RI+FWC+Q+ +RPS+GEV+ VLEGTL+VD PP Sbjct: 709 LERVLRIAFWCLQNDERMRPSMGEVLNVLEGTLTVDPPP 747 >ref|XP_004234895.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1-like [Solanum lycopersicum] Length = 281 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 E +ER RI+FWC+Q +RP +GEV+KVLEGTL+VD PP Sbjct: 218 EELERALRIAFWCLQDDERMRPPMGEVIKVLEGTLTVDPPP 258 >ref|XP_007028817.1| Curculin-like lectin family protein / PAN domain-containing protein, putative [Theobroma cacao] gi|508717422|gb|EOY09319.1| Curculin-like lectin family protein / PAN domain-containing protein, putative [Theobroma cacao] Length = 766 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPP 200 E +ER RI+FWC+Q ++PS+GEVVKVLEGTL VD PP Sbjct: 702 EELERALRIAFWCLQTDERVKPSMGEVVKVLEGTLPVDPPP 742 >gb|EMT25759.1| Putative serine/threonine-protein kinase receptor [Aegilops tauschii] Length = 827 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -1 Query: 325 LEAMERIARISFWCMQHQPFLRPSIGEVVKVLEGTLSVDRPPSRMGPRQHSGM 167 LE ERI +++FWC+Q F RP++GEVVK+LEG +D PP PRQ + M Sbjct: 775 LEEAERICKVAFWCIQDNEFDRPTMGEVVKILEGLREIDMPPM---PRQLAAM 824 >ref|XP_002299111.2| hypothetical protein POPTR_0001s04320g [Populus trichocarpa] gi|550346489|gb|EEE83916.2| hypothetical protein POPTR_0001s04320g [Populus trichocarpa] Length = 885 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 322 EAMERIARISFWCMQHQPFLRPSIGEVVKVLE 227 E +ER+ RI+ WCMQ+QPFLRPSIGEVVKVLE Sbjct: 697 EEVERVVRIALWCMQNQPFLRPSIGEVVKVLE 728