BLASTX nr result
ID: Mentha26_contig00049186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00049186 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18978.1| hypothetical protein MIMGU_mgv1a006424mg [Mimulus... 64 3e-08 ref|XP_002298354.2| hypothetical protein POPTR_0001s24730g [Popu... 57 3e-06 >gb|EYU18978.1| hypothetical protein MIMGU_mgv1a006424mg [Mimulus guttatus] Length = 444 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 309 RRKGFDFREIVLRNRSIGKLDWRNWTPSLVRT 214 RRKGFDF E+V RNRSIGKLDWRNWTP LVRT Sbjct: 413 RRKGFDFVELVRRNRSIGKLDWRNWTPGLVRT 444 >ref|XP_002298354.2| hypothetical protein POPTR_0001s24730g [Populus trichocarpa] gi|550348103|gb|EEE83159.2| hypothetical protein POPTR_0001s24730g [Populus trichocarpa] Length = 451 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = -1 Query: 309 RRKGFDFREIV-LRNRSIGKLDWRNWTPSLVRT 214 R+K FD RE+V LRNRSIGKLDWRNWTP LVRT Sbjct: 418 RKKVFDIREMVNLRNRSIGKLDWRNWTPGLVRT 450