BLASTX nr result
ID: Mentha26_contig00049050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00049050 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039419.1| Phosphoenolpyruvate carboxylase family prote... 58 2e-06 >ref|XP_007039419.1| Phosphoenolpyruvate carboxylase family protein, putative [Theobroma cacao] gi|508776664|gb|EOY23920.1| Phosphoenolpyruvate carboxylase family protein, putative [Theobroma cacao] Length = 270 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +2 Query: 2 ASMGYLRDPGNAKVKEVLHGAERAVLKSGAAYLSGIITAHDP 127 ASMGYLRDPGN KVK++++ AE VL GAAYL+G HDP Sbjct: 194 ASMGYLRDPGNEKVKKMMNVAEATVLGGGAAYLAGFSMPHDP 235