BLASTX nr result
ID: Mentha26_contig00048934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048934 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT25178.1| Chaperone protein dnaJ 15 [Aegilops tauschii] 59 5e-07 >gb|EMT25178.1| Chaperone protein dnaJ 15 [Aegilops tauschii] Length = 375 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = -2 Query: 163 GRVVNLNREKF*KSEGEAGEFWRVIMAGTKMEGPSAPALRRDPYEVLSVTRDSS 2 G + L R S G G + ++ + KMEGPSAPALRRDPYEVLSV+RDSS Sbjct: 3 GEEIGLTRHPMSLSVGRLGGYCSLMASSGKMEGPSAPALRRDPYEVLSVSRDSS 56