BLASTX nr result
ID: Mentha26_contig00048746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048746 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19293.1| hypothetical protein MIMGU_mgv1a017958mg [Mimulus... 49 8e-06 >gb|EYU19293.1| hypothetical protein MIMGU_mgv1a017958mg [Mimulus guttatus] Length = 383 Score = 48.9 bits (115), Expect(2) = 8e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -3 Query: 143 DVISYNSMIQGLCDVSRLVDVTDLLNEMADANVSLT 36 DV++YNSMIQGLCD R +V +LLNEM + +SLT Sbjct: 37 DVVTYNSMIQGLCDFGRWREVKNLLNEMVNRKISLT 72 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 VVTFNILIDAFC 1 VVTF+IL+DAFC Sbjct: 73 VVTFSILVDAFC 84